CAZyme Information: EKG14626.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG14626.1
• CAZy Family: GH16
• CAZyme Description: Glycoside hydrolase family 16

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1031		115811.58	7.2819

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000339:48282-51377(+)

Full Sequence      

MASSTMQSCLAAALLALLFLASPASAAAADCSCGFYDDTTGDLFTESLIQYFNETSDLDE
FILENFEHKAEKSWNSKFRQGALPGNVVNNSTSLELYCDPYTDNHVVNGGSLRSVRRDIQ
YGSFRSLMRGPRQGMGGSSMTMRLLFNETESLEINVMNTDSNATAWVSTLMQNEWPGRDL
GINYTVLGNSSLANGTAWPWDFMEFRIDWTDKEVRYYVGQNNSRTVTKKKHGHIPTTPSP
LYFRHWSTGNTYSMEGPPHWRSVANVGWMRMFFNTSTMTTEQHKEFDARCTVQDACSMDD
MSLRLVSSYPTNATVKWKHHDPRGGLLTAPLWISVIMAIFSTFLLIHAFVKKAIGKRAAP
GHGHGSVTEVGSGSDRSSPVPPYRSTEPSIIVSGSGTPFNQTRPGTPEKKNSNEAFPRRS
DFTPSASGCSTPLPRYESREYLGRFDEDAITPASSTPTLPNVAPDASAYPASTRASSLRN
AVVYTDSSAVPEYALPDSARDSAQTLVTKAPSSPVLPKSPASPPPWSPKIREKGFGAARV
REVAEEPREHPLKNATSAADTKPVDKIPTAKKARVDYLAGLVALCSIFVTLIHFHLTYIP
AVVIPGAFVHYPSELWAEKLISPFIMNQMWLGVFFTTSTRFLCARYFREGKLDVIAERAV
KRAPRLMIPVTAMVLLEYFFIDVGATKYLEYLPSVTWSTWGYVAKFPSVGHFISEVLELV
YLIPNAVPQITFNYCTGVLWTIAVQLQGSWVVLLGAIVIREVKTPWKRFGYYAFCVVNNW
YARNWGSFFWLGLMLTDLDITFKWRKYLYPRPLVYYPLIGFCIFCTLVGFTMNLLPQWIS
YNFTTHENGIHPDQETGLPIVDTANYGYPNYYEPRFNMLLFAVGMQAIVELSTVVQKILS
FPVLVWVFPHIFTIYLIHGFIFWSWGAWLCVFLAGKDLVYWLNIFIVGITCYAIIILSLP
IVTPAIEILGRDITVNIWEFANVKPPPKKDTLYPFSKDELGMEGEKSEEHAKSKEEHGEK
YEAKFDERNGV

Enzyme Prediction     

No EC number prediction in EKG14626.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	89	270	2.6e-22	0.9322916666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.01e-11	84	272	29	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
376607	Acyl_transf_3	4.46e-11	575	957	1	327	Acyltransferase family. This family includes a range of acyltransferase enzymes. This domain is found in many as yet uncharacterized C. elegans proteins and it is approximately 300 amino acids long.
224748	OafA	1.76e-09	572	981	12	373	Peptidoglycan/LPS O-acetylase OafA/YrhL, contains acyltransferase and SGNH-hydrolase domains [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD48161.1|GH0	1.63e-245	30	996	54	1028
SAM84175.1|GH0	2.04e-83	17	978	17	1187
CDI55223.1|GH0	1.28e-80	16	978	16	1187
SJX64811.1|GH0	7.14e-79	16	978	16	1194
SJX62004.1|GH0	3.51e-73	16	952	11	1189

PDB Hits     

EKG14626.1 has no PDB hit.

Swiss-Prot Hits     

EKG14626.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999800	CS pos: 26-27. Pr: 0.9854

TMHMM  Annotations     

Start	End
328	350
578	600
620	642
663	685
737	759
771	793
813	835
876	895
910	932
939	961