CAZyme Information: EKG14418.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG14418.1
• CAZy Family: GH146
• CAZyme Description: Glycoside hydrolase family 28

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	AHHD01000348|CGC1	48671.78	4.3631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000348:94042-95536(-)

Full Sequence      

MVFQGFLTIVAVALCLPDALAATVSETFLDSIRSARPVTAQSSPARNRTCIVESHNDGTT
DDSDYILAALEDCNNGGHVIFPGSQIYAINEALDMTFLSSVDVDIQGTVKFTDDIEHWLN
STFDLGFQNATSFFKLGGEDVNVYGGGTIDGQGQVWWDNYAKNKHDRRPVLFATVELHGG
TISDINLRNSPFWHNFVGNSSNVEFTNISIHSVSNNENFEKNTDGWDIYRSEYITVQNSS
VTNGDDCVSFKPNSTNVLVRNMVCNGTHGMSVGSLGQYPDRVDYVENIYVYNAAMYNSSE
GARIKVWPNAFSEKSANLVGGGGTGLVRNVTYDTMWLDNVDYGLTITQCYGQDDEEECFK
HPSKLNITDVTFRNIRGRTNRVFAPIVAHLVCSSPDTCSNIVAEDIDIRTINGSNLVTCR
NMNEDTLDVNCVDWSKGYNPA

Enzyme Prediction     

EC	3.2.1.67:7	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	73	425	4.8e-79	0.963076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.11e-47	90	423	14	316	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	2.02e-37	54	421	44	389	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	5.22e-32	7	416	15	402	Probable polygalacturonase
177865	PLN02218	2.39e-27	57	423	78	419	polygalacturonase ADPG
215540	PLN03010	3.56e-24	57	428	57	395	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX92520.1|GH28	1.57e-218	1	441	1	443
QDS76272.1|GH28	7.68e-212	8	441	7	443
CAE7030548.1|GH28	4.39e-159	39	432	47	439
CBX91370.1|GH28	2.23e-158	43	431	51	438
AAC26146.1|GH28	1.25e-155	37	437	42	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	2.55e-77	50	437	19	388	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
6KVE_A	2.70e-31	93	422	42	338	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	2.70e-31	93	422	42	338	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	1.16e-30	93	422	34	330	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1HG8_A	2.43e-28	66	377	11	303	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00359|PGLRX_COCCA	2.23e-156	37	437	42	443	Exopolygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGX1 PE=3 SV=1
sp|Q00293|PGLRX_ASPTU	8.16e-154	43	432	43	431	Exopolygalacturonase X OS=Aspergillus tubingensis OX=5068 GN=pgaX PE=1 SV=1
sp|A2R060|PGLRX_ASPNC	2.32e-153	36	432	38	431	Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaX PE=3 SV=1
sp|Q27UB3|PGLRX_ASPNG	2.32e-153	36	432	38	431	Exopolygalacturonase X OS=Aspergillus niger OX=5061 GN=pgaX PE=3 SV=1
sp|B0YDE8|PGLRX_ASPFC	4.21e-153	43	432	44	432	Probable exopolygalacturonase X OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgaX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003812	0.996167	CS pos: 21-22. Pr: 0.9735

TMHMM  Annotations     

There is no transmembrane helices in EKG14418.1.