CAZyme Information: EKG14325.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG14325.1
• CAZy Family: GH13
• CAZyme Description: peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	AHHD01000359|CGC1	49370.84	4.4561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000359:79647-81079(+)

Full Sequence      

MATHDADAGTGGLDASIMFETERDENVGDAFNGTFGFTNNYYNIKASAADLLALSTVIAV
GNCGGPKIPFRVGRVDATEAGPLGVPKPDQDVDTHIQIFAKAGFNTSDMITMVACGHTLG
GVHGKDFPEITFNDTETNFVKFEGNNSFSNFDNTVVTEYLGGNPPNPLVTGKNETNNSDK
RVFGADNNATMHSLSDPSVFQSSCQDILARMIDTVPSNVALTEPLDPILIKPYIQTFSLV
NATHLTLTGRIRVRTDWDSYTDQSVHLTYNPRTAPAQNATLNTTIPTTRATFQGGTSSGI
FGEVFAWHEFSATLPTSSSITGFTVTVTRGSTGESTTYDNAGSTNGYALDDTLLYQSAQS
CRDVGTTTITAAVRKDFLARGAKVAVEMVNRVPRQGVYVPALEVEPWGAETVKEVGEWVI
VQAKGELTMESLSTTFDVVAGEKRVEFQRTNVLGEECAAL

Enzyme Prediction     

No EC number prediction in EKG14325.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	4	137	4.3e-24	0.5568627450980392

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	1.26e-101	1	213	53	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
395089	peroxidase	4.64e-23	7	123	26	155	Peroxidase.
173823	plant_peroxidase_like	1.99e-22	1	212	24	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
173825	ascorbate_peroxidase	2.35e-15	2	167	42	201	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173826	ligninase	2.28e-13	4	120	47	177	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW22025.1|AA2	1.70e-104	3	459	80	537
QKD59397.1|AA0	2.13e-103	3	458	76	530
QGI68923.1|AA0	4.14e-100	3	458	76	530
QRV94524.1|AA2	9.17e-97	3	458	79	533
QRV79935.1|AA2	1.29e-96	3	458	79	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L86_A	2.41e-07	47	123	90	167	engineered ascorbate peroxidise [Glycine max],5L86_B engineered ascorbate peroxidise [Glycine max]
4FCS_A	3.82e-07	9	135	57	189	The crystal structures of several mutants of pleurotus eryngii versatile peroxidase [Pleurotus eryngii]
3RIW_A	5.26e-07	45	123	85	166	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]
2Y6A_A	5.94e-07	47	123	91	168	Ascorbate Peroxidase R38A mutant [Glycine max]
2XI6_A	5.94e-07	47	123	91	168	The structure of ascorbate peroxidase Compound I [Glycine max],2XIF_A The structure of ascorbate peroxidase Compound II [Glycine max],2XIH_A The structure of ascorbate peroxidase Compound III [Glycine max],2XJ6_A The structure of ferrous ascorbate peroxidase [Glycine max],5JQR_A The Structure of Ascorbate Peroxidase Compound II formed by reaction with m-CPBA [Glycine max]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	1.16e-63	1	458	75	513	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q7XZP5|APX5_ARATH	4.38e-10	3	168	43	198	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2
sp|Q93V93|PER44_ARATH	1.38e-09	47	129	115	199	Peroxidase 44 OS=Arabidopsis thaliana OX=3702 GN=PER44 PE=2 SV=1
sp|Q1PER6|APX2_ARATH	1.54e-08	47	123	93	169	L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=APX2 PE=2 SV=3
sp|Q8GY91|APX6_ARATH	2.82e-07	3	120	127	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997970	0.002058

TMHMM  Annotations     

There is no transmembrane helices in EKG14325.1.