CAZyme Information: EKG13832.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG13832.1
• CAZy Family: GH105
• CAZyme Description: Glycoside hydrolase family 31

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	AHHD01000383|CGC1	49957.79	4.9456

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000383:45613-47029(+)

Full Sequence      

MPLVSVWLQDWSGTRLQAGAYNVSISRLWWNWEPDATLYPTWAEWVPHLRSEYGVRTMSY
VNTFLANVSSKTTGYNRSFYAEAAAEGRFVLNATAGDGSPWTVTSGPGIDAGLLDLSNET
TRQWFKDLYKEQYYSVPISGAMQDFGEYLDVTSVVSISSGTINPRLFHNEYPAAWAKLLR
EVVEELGLANDTIGFHRSASTFSLPHTNLFWVGDQNIDTSREDGMRAAISSALHVGLSGF
AQSHSDIGGYTNTLAPVGNITRSAALLGRWGEMGAFGGAAFRTHEGNIPQVNAQAYTNAS
TLAYHSYNARLFAALKTYRKSVVGEYQRSGWPLLRHPVVYAPRDERAVATVDEVFWLGEA
LLVAPVYDVEAQTLEVYLPRIEVGSDGQAVEGAQYKHLWTGQLFEPGETVTVDAPWGKPG
IFVRWPLKDGEDEALQGLWDFVKKENGTALTA

Enzyme Prediction     

No EC number prediction in EKG13832.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	3	424	8.5e-53	0.8477751756440282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269880	GH31_glucosidase_YihQ	1.87e-134	1	309	37	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
236691	PRK10426	1.75e-111	1	435	235	626	alpha-glucosidase; Provisional
224418	YicI	1.62e-46	1	442	294	687	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	5.80e-33	30	424	75	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	1.48e-25	31	379	49	360	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39259.1|GH31	1.79e-144	2	452	323	768
UJO15759.1|GH31	7.12e-144	2	451	330	766
BAE62256.1|GH31	7.75e-143	2	450	322	765
QMW32300.1|GH31	8.42e-143	2	450	325	768
QRD83751.1|GH31	8.42e-143	2	450	325	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AED_A	2.88e-63	6	424	285	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	1.49e-62	6	424	285	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
6PNR_A	2.46e-62	1	424	265	649	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5OHY_A	4.36e-58	6	424	267	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	2.23e-57	6	424	267	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	1.30e-62	6	424	285	663	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|Q8BVW0|GANC_MOUSE	9.82e-11	80	386	433	726	Neutral alpha-glucosidase C OS=Mus musculus OX=10090 GN=Ganc PE=1 SV=2
sp|B9F676|GLU2A_ORYSJ	1.31e-10	80	396	448	753	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|P31434|XYLS_ECOLI	2.83e-10	29	399	315	639	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q6NSJ0|MYORG_HUMAN	1.81e-08	35	415	366	701	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999932	0.000108

TMHMM  Annotations     

There is no transmembrane helices in EKG13832.1.