CAZyme Information: EKG13578.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG13578.1
• CAZy Family: GH1
• CAZyme Description: Bacterial alpha-L-rhamnosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660		71285.81	6.7833

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000406:8442-10424(+)

Full Sequence      

MHLSSRIGVLLPLVAAALHCADAADEPWKRFILSPHSRTVQPISVHSISGDAIVTSNSDG
IVLTLNPSAQVSLDFGVEVGGLLSFNTKTEASSTPLLALAFAESPLNVREISDDATGSVA
SQDWDRELNVSLPKGVWHYSMPAERFRGGFRFVTVTARAPIVLTNITCGIGFSPSQADLT
DYSGHFFAPQDELLTRIWYAGAYTTQTNIGPANSGRFLPQVRPGWSYNSSAGVAGPLLMD
GAKRDRAVWPGDHGISGQTALLALGEAGLQAFHNSLETMFYYQNSTTGRFPYAGPSTRSF
NGRNASDTYHAWNLIAIYNYAIFTGDQAWVEGHWKSISRGVDYILAGLNNTVGLHNQSTR
YDWGRQGAGEYNSALNALDYHALNRLSSLAVSLRKTDLASSWMAAAARLKAAYNKFLWDF
DISLYRDNTTTSLHPQDGNALALLFNLTENTGQAAALSLALTRNWNSIGPVTPELPDVIS
PFISGVEVLGHFKAGNASRALQLTRRLWGYLLDSPIMTGSTFAEGLAANGSLYYRGASGY
NFDAAYTSMSHSWSSAPTIALTTRVAGLEITGWLEWTFAPQPGGLSEATSGFRTPFGHFR
VEWVVRNGTFTATLETPPGTTGSVNLPWRCGSVTIDGLRWTGLSVKGGSTHFLHASGCQE

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	67	626	1.7e-69	0.9900793650793651

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	3.50e-10	572	627	8	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	2.81e-06	240	514	34	303	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84466.1|GH78	5.39e-235	13	659	22	699
QRD88907.1|GH78	8.21e-141	28	637	46	657
UCK57529.1|GH78	1.29e-139	28	637	46	657
ARH52639.1|GH78	1.20e-138	28	637	39	645
ATZ56650.1|GH78	1.45e-137	23	647	38	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.91e-07	61	601	184	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

EKG13578.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999676	CS pos: 23-24. Pr: 0.9650

TMHMM  Annotations     

There is no transmembrane helices in EKG13578.1.