CAZyme Information: EKG13389.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG13389.1
• CAZy Family: CE5
• CAZyme Description: Glycoside hydrolase family 76

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300		33502.03	9.7727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000413:80478-81380(-)

Full Sequence      

MFGALIDYWYYTDDDQFNDITTQALVHQMGEDADFMPANQSKSLGNDDQGFWGLAAMAAA
ENKYPDPPEGPGWLALSQAVFNEQAGRWNTETCNGGLKWQIFTFNQGFDYKNTISQGCFF
SLASRLARYTGNTTYSDWAEKTWEWTKNVGLMSDDYHFYDGTSDASGKNCSSKDHTQWTY
NAGIFLYGAATMWNIVSRKPWPANPFKPKSSVHYSHLTPHHHRAPKLATRTTSGASAPKA
SSRGSPSFSPKRRPTSSPRWRAKPAARATSTSALSRRTSRAGWPRPPRSRPGPSTPWSPS

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	1	201	4.5e-64	0.5167597765363129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.89e-104	1	195	41	234	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
223039	PHA03307	0.004	218	281	330	393	transcriptional regulator ICP4; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX93371.1|GH76	2.62e-97	1	198	47	243
QDS70153.1|GH76	1.48e-94	1	195	74	267
UJO10931.1|GH76	1.05e-93	1	194	68	260
UQC87729.1|GH76	5.58e-93	1	201	16	216
UQC82430.1|GH76	2.18e-92	1	201	71	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.69e-64	1	201	82	283	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	1.28e-69	3	201	73	272	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	6.59e-69	3	201	70	269	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	2.95e-68	3	201	73	274	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	1.02e-65	3	201	70	269	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	2.44e-64	3	201	71	268	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999630	0.000414

TMHMM  Annotations     

There is no transmembrane helices in EKG13389.1.