CAZyme Information: EKG12688.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG12688.1
• CAZy Family: CBM67
• CAZyme Description: Glycoside hydrolase family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728		79725.91	5.1475

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000442:37391-39682(+)

Full Sequence      

MQRGPLGRRGFESFSEDPFLAGAMSAATVDGIQSTGVAATIKHFVCNDQEHERQAVDSIV
SERAIREIYLMPFQIAQRDAQPMAYMTAYNRVNGVHMSDNKKILQGILRDEWGFDGLVMS
DWFGTYTSADSVNAGLDLEMPGPPRVRGQQTLIAHSVRKISDDTIDERVRKVLELVNKVD
KLNIPENAPERSIDSPETSKALRNVAASGLVLMKNEKNVLPLKKEQSLAVIGPNAKIAAY
AGGGSANLRPYYAVTPLEGISAQKSDVKYSLGAVGYRSLPVLSYLTKTKDGDRGLTARFF
KEPPTDKSRKHVDEVHVEASDILLSDYKHPEITSDTFYMDLEGILTPEESGEYIFGVSVC
GTAKLFIGDKLVVDNTENQRQGDTFFGSGTVEETGTMQLEAGKSYQVYLQFGSSTTSNMK
TPGATVMAGGGVRVGGTKQTDPQVEIEKAVVLAKEVDQVVVIAGLNGDWESEGYDRRHMD
LPGYTDALISAVAAANPNTAVVMQSGTPVCMPWIDEVPALVHAWYGGNETGNAIADVIFG
TVNPSGKLSLSFPVRNEDNPAFLNFRSERGRALYGEDVYIGYRFYEKTKRDVLFPFGHGL
SYTSFDISNLQVTDDDAGEKITIKVDVKNTGALEGAQVVQVYVSQRHPSINRPPKELKGF
AKVLLKPGEVRQATVHVSKKYAASFWDELKDAWIMEKDEYDVLVGDSSASTPLQGSFKVG
ETSWWKGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	2	141	1e-47	0.6666666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.12e-67	3	717	163	762	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.10e-56	210	602	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	3.82e-49	1	237	124	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.14e-38	3	677	162	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.54e-31	3	175	131	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO24157.1|GH3	0.0	1	728	107	834
SMR64317.1|GH3	0.0	1	728	109	836
SMR61167.1|GH3	2.74e-317	1	728	109	836
SMY29662.1|GH3	2.74e-317	1	728	109	836
SMQ55981.1|GH3	3.97e-316	1	728	109	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.53e-234	1	728	105	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.02e-229	2	728	106	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.43e-115	1	722	111	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.38e-97	1	708	112	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.30e-88	1	726	122	720	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DFA8|BGLI_NEOFI	1.09e-291	1	728	105	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.29e-290	2	728	106	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.44e-289	2	728	106	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.11e-289	2	728	106	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WU49|BGLI_ASPFU	5.80e-289	2	728	106	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EKG12688.1.