CAZyme Information: EKG12490.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG12490.1
• CAZy Family: CBM21
• CAZyme Description: Pectate lyase/Amb allergen

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		33727.82	6.4070

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000449:28962-29987(-)

Full Sequence      

MKFLSTLALAALAHLACAVPMAEKRAPAATPVGYASQNGGVTGGQGGTTTTVSSLPEMTA
ALKKGDTEKKVVYVKGKISGKAKIYVGSNKSILGVDSSSGLEGIGLLVRDAKNVIIRNLA
ISKVEADTGGDAIAIDGSTNVWVDHCDLSSDLAADKDFYDGLLDISHGADYVTVSNVYFH
DHHKNSLVGHSDSNAGEDTGKLHVTYANNYWSNVGSRCPLVRFGTVHIVNNYFEDVSVSG
INTRMGAQVLVENNVFNNVVQALVSIDSKELGYAVARGNDWGTSKNEAPEGTLTKVPYTY
TAVEASAVKAAVVGSAGNTLSGL

Enzyme Prediction     

EC	4.2.2.2:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	74	256	5.1e-87	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	5.15e-67	74	248	2	178	Amb_all domain.
226384	PelB	3.87e-54	57	317	64	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.85e-40	81	248	27	203	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI41234.1|PL1_7	6.28e-119	1	320	1	326
QPC72395.1|PL1_7	2.54e-118	1	320	1	326
QPC63510.1|PL1_7	5.10e-118	1	320	1	326
CZS74637.1|PL1_7	1.03e-117	1	320	1	326
CAW70624.1|PL1_7	1.45e-117	1	320	1	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	1.42e-46	31	312	4	316	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.65e-37	29	269	6	287	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
2QXZ_A	8.23e-33	88	317	72	323	Chain A, pectate lyase II [Xanthomonas campestris pv. campestris],2QXZ_B Chain B, pectate lyase II [Xanthomonas campestris pv. campestris]
2QY1_A	8.23e-33	88	317	72	323	Chain A, Pectate lyase II [Xanthomonas campestris pv. campestris],2QY1_B Chain B, Pectate lyase II [Xanthomonas campestris pv. campestris]
1OOC_A	7.59e-31	21	234	4	258	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CYB8|PLYA_NEOFI	1.45e-103	1	320	1	319	Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyA PE=3 SV=1
sp|Q4WIT0|PLYA_ASPFU	4.39e-100	1	320	1	319	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1
sp|B0XT32|PLYA_ASPFC	4.39e-100	1	320	1	319	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1
sp|Q5AVN4|PLYA_EMENI	6.12e-99	33	320	44	325	Pectate lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyA PE=1 SV=1
sp|Q9C2Z0|PLYA_ASPNG	3.07e-98	33	320	40	321	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999769	CS pos: 25-26. Pr: 0.9656

TMHMM  Annotations     

There is no transmembrane helices in EKG12490.1.