CAZyme Information: EKG12277.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG12277.1
• CAZy Family: AA8|AA3
• CAZyme Description: Glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748		81001.89	7.3050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000453:62039-64462(-)

Full Sequence      

MAESSTGPVTIKDSPLPPLAGEDPLSPAQWTTLLAFADAVVPSIAPSTIAKPSTQLAVDA
NTYATTLAGVQQLAGPDVDPQLSAEYLAETPSACPAFRDNIRRLMAQYIPADVRKQLLMA
LNVLDTRPGALVMTGYPTPFAKQPVDIRIAILQRWGIARTPIFRQLNRLLTTLIKQNWAK
TSATLGRVLGFPRVPVHGSVGKGFEFEFIQMPPGDGPETLDTDVVIVGSGCGAGVCAKNL
AEAGHRVIIVEKSYYWPPEHLPMKDTEGFSHLFMNGGSIISDESCVSVAAGQTFGGGGFV
NWSASLQTQGYVRQEWADQGLPLFTSAEFQKSLDIVCERMGVATDPIRHNPTNNHLLEGA
RKLGWSCKPVPQNSGGAEHYCGSCSLGCASYEKQGPHVSFLPDAARSGARFIEGIEVQKI
LFEEKKGKRIAVGVRGLWVSRDENGGVAGTPCITRDVIIKAKRVIVAGGTMQSPLLLLRS
GLNNPNIGRHLHLHPVSFLGAVHKERTNPWEGGILTAVVNEFENLDGKGHGAKLEAITML
PSVWLTLAPWIGGLEYKEFVPRMKHMVGYISLARDRDTGRVYPDPADGRCRLSYPLSWFD
KKNILEGVIGLAKVQYVAGASEIFTTIPGCPAFKRTEAAMEKDDLEGINNEKFQEWLKEV
RRYGLPSPGTLFLSAHQMGTCRMGASPRTSVVDAEGKVWGTEGLYVADASVFPSASGVNP
MVTVMAIADWLSRNISAHMAQEQELARL

Enzyme Prediction     

No EC number prediction in EKG12277.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	221	737	5.1e-58	0.9671532846715328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	1.88e-60	272	496	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	1.86e-41	223	738	9	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.83e-30	575	728	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	6.38e-13	222	728	1	479	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	2.49e-10	676	728	473	524	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	2.32e-215	16	748	16	744
ADT70774.1|AA3_1|AA8|CBM1|1.1.99.18	1.26e-13	223	737	257	794
BAE61169.1|AA3_1|AA8	9.86e-12	223	737	255	788
QMW43910.1|AA3_1|AA8	1.03e-11	223	737	309	842
QMW31885.1|AA3_1|AA8	1.03e-11	223	737	309	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	2.25e-09	217	742	225	770	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
2JBV_A	4.90e-08	464	746	265	537	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3LJP_A	4.90e-08	464	746	265	537	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	4.90e-08	464	746	265	537	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
4QI4_A	3.19e-06	217	737	3	544	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	2.55e-91	220	742	237	749	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	7.13e-88	223	743	238	748	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q9LW56|FAO3_ARATH	9.55e-86	220	739	231	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	1.00e-80	92	735	62	738	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|O65709|FAO4A_ARATH	3.30e-78	220	735	222	718	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999919	0.000111

TMHMM  Annotations     

There is no transmembrane helices in EKG12277.1.