CAZyme Information: EKG12023.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG12023.1
• CAZy Family: AA7
• CAZyme Description: Glycosyl transferase family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862		96897.21	4.9983

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000462:225671-228420(-)

Full Sequence      

MAFDRASSHGTPGAESPPDVTPAETPGGLTPMYQSRNGSTAGFSVYSQSRRDTQFIHDIR
HDIIINHLYEKQVGQRWIQDFSGNVEGVLLKKARGEYITFPEQLVESNLAQSIATLNVQA
AMTVKTKVVSTFIARNTEAEIPIRKGLRVQVIPTIEELVYARKHQYAAFVASESLLLVWD
DNPENLAARAESIQEDLLKSAMSSYEAGFGEKGGMVEEAEIDVEAATEKERPTVYYNSVC
TAFAIVILVTLSGLGWQAIAREVALLKSYMSILFVLMTPINFFFALFFCNVIVSIFARVL
GPVSYLEQNSKYYSAKCSPRIEKSANGTLPHVTIQCPVYKEGLDSVIAPTVRSIKKAIST
YELQGGTANILIHDDGIQIIDEEERQARIEFYADNNIGWTARPKHGHDGFIRRGKFKKAS
NMNFGLRLSNLVEKKLQEISRGDHWTSRDENEAYDACLSKVLEEEQVAWAAGNIRVGDYI
IIIDSDTEVPEDCLLDAVSEMEHCPDVAIIQFASGVMQVSWDFFENGITFFTNLIYSSIC
FGVASGDVAPFVGHNAILRWSAVQQVSFIDDLGEERFWSETSVSEDFDMALRLQIEGYIV
RLAAWADGGFKEGVSLTVYDELARWEKYAYGCNELVFNPMYQWIYKGPFTTLFKTFIASS
MPLASKLNIISYIGTYYAIGSSWLLTLINYVVIGEFNGYYDKYYLESWKVWLSVILVFTI
GGNIGLAVERYRLGQRGLLGSLFENFKWCFMFVVFFGGISIHVSQAILSHMFCIDMQWGA
TAKEVERSNFFLEVPKIAKRFKWSMLFCFALLAGMVIMAEAPFIPWSWNITQFVAIFPLS
VMVGCHILLPIVLNPSLMAFTF

Enzyme Prediction     

No EC number prediction in EKG12023.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	479	687	3e-53	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.93e-49	479	685	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.49e-11	272	774	1	408	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.77e-09	337	586	4	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133034	Glucan_BSP_MdoH	4.74e-09	471	624	82	243	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
133043	CESA_CelA_like	6.70e-09	330	601	1	201	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC83874.1|GT0	0.0	30	861	50	882
ANH56545.1|GT0	0.0	30	861	61	894
AEO64878.1|GT0	0.0	4	861	30	891
UNI13811.1|GT0	0.0	30	861	58	890
QUC18054.1|GT0	0.0	30	861	59	892

PDB Hits     

EKG12023.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q83Z42|OPGH_XANEU	5.27e-06	465	631	218	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas euvesicatoria OX=456327 GN=opgH PE=3 SV=1
sp|B0RNI5|OPGH_XANCB	5.28e-06	465	631	218	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=opgH PE=3 SV=1
sp|Q3BXV7|OPGH_XANC5	5.28e-06	465	631	218	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=opgH PE=3 SV=1
sp|Q4UYZ8|OPGH_XANC8	5.28e-06	465	631	218	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=opgH PE=3 SV=1
sp|Q8P532|OPGH_XANCP	5.28e-06	465	631	218	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

Start	End
234	256
271	293
523	545
669	691
711	728
748	770
806	828
833	855