CAZyme Information: EKG11701.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG11701.1
• CAZy Family: AA7
• CAZyme Description: Glycoside hydrolase family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	AHHD01000467|CGC2	69670.05	4.5606

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000467:491509-493413(-)

Full Sequence      

MRTPVLHTSTTKPQGSWASIFVAALASISAVSARALPRGAAQNETVPAYRNPTLCIDERL
DDLIQRMTLEEKAGQLFIKQIPMGTNGTIDIETKTDNYTSADLISQKLMSHFNLQSSGKA
SDIANWHNSIQELALQTRLGIPITIATDPRHSFAETAGSAVGVGSFSQWPETLGLAALRS
PELVQRFAEIAREEYMAVGIRSALSPQIDVTTEPRWARSGQTYGEDANLTSSLVVGYLKG
FQGETLGRHSVTTVTKHFPGGGPGQNGNDSHFETGKNNVYPGGYFDYHLEPFRAAIAAGA
RQMMPSYARPIGTKYEEVAMGFNKGIVTDLLRDELGFDGIVVSDWGLVTNFTARGEEMEA
ISWGVENLSEIEKVEKILNAGVDQLGGEIRTELVIQLVNEGAISEERIDVSVRRLLREKF
VLGLFDNPFVDPDAADAIVGNDYFRRVGNETQRRAYTLLKNDDDLLPLTLDADTKFYADG
FNASYLLERGLAVVDTPEEADYAFLRLSTPYEARGGGFERNYHQGRLDFNETEKARHAAI
TQTVPTIVDIYLDRPAVIPELAEDSAALLGNYGASVDAFLDIVFGTEGWKPEGKLPFDLP
RSMEAVEANKEDVPFDTENPVFRYGHGLSYAEKC

Enzyme Prediction     

EC	3.2.1.21:5	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	135	384	4.5e-58	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	7.85e-55	67	461	1	343	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.40e-46	68	417	1	315	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	1.93e-39	60	632	38	650	beta-glucosidase BglX.
178629	PLN03080	1.13e-13	22	428	16	372	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.73e-04	475	630	58	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUM60063.1|GH3	3.91e-276	34	634	36	637
UQC87911.1|GH3	2.10e-273	44	634	38	634
SMR43413.1|GH3	5.78e-272	40	634	38	631
SMQ47046.1|GH3	5.78e-272	40	634	38	631
SMR45573.1|GH3	2.34e-271	40	634	38	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	1.84e-57	13	631	7	615	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6JGQ_A	5.42e-47	49	629	9	602	Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGR_A Crystal structure of barley exohydrolaseI W434Y in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGS_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with 4I,4III,4V-S-trithiocellohexaose. [Hordeum vulgare subsp. vulgare],6JGT_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]
6JGG_A	1.90e-46	49	629	9	602	Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGK_A Crystal structure of barley exohydrolaseI W434F mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6LBV_A Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare],6LC5_A Crystal structure of barley exohydrolaseI W434F in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare]
1LQ2_A	2.36e-46	49	629	5	598	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	2.46e-46	49	629	5	598	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NGU6|BGLC_ASPFN	9.50e-267	36	634	26	626	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
sp|Q2UFP8|BGLC_ASPOR	1.46e-264	36	634	30	630	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
sp|Q5BCC6|BGLC_EMENI	9.24e-251	42	633	31	618	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
sp|Q46684|BGLX_DICCH	2.09e-134	49	630	58	654	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
sp|T2KMH9|PLH34_FORAG	2.60e-42	49	631	29	639	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000716	0.999255	CS pos: 35-36. Pr: 0.6890

TMHMM  Annotations     

There is no transmembrane helices in EKG11701.1.