CAZyme Information: EKG11562.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG11562.1
• CAZy Family: AA5
• CAZyme Description: Cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		32245.19	9.9221

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000467:114094-115059(+)

Full Sequence      

MPRPQYYEDPWRGQSALFSYSFPYNIALCGQRKIPRLFWFLHMQVSPWLPCHLSALNLPN
IKPTGSRSFALLSSLSNFTAALEASLLIHSLHLFHFLTANPTQITKMVAVTHQILLTLAA
TAMALPAEMSLSIEARAPQFSIPGGSLGGSSTSNDVTSGVCKPVTYIFARGTTETGNMGT
TVGPALKQKLEQALGAGQVATQGVNYPADFAGALRGSISPKTASGSTNCASLVKQALSKC
PDTKIVLAGYSQGAQQVHGCLMNLGSTEAAKVAVSASPRRSVEMSKRVGFLSITSLHHHF
ALP

Enzyme Prediction     

No EC number prediction in EKG11562.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	161	271	4.5e-30	0.6031746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	8.22e-35	161	274	2	112	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATA58075.1|CE5	7.94e-82	107	286	1	190
ATA58080.1|CE5	7.94e-82	107	286	1	190
ATA58093.1|CE5	7.94e-82	107	286	1	190
ATA58198.1|CE5	7.94e-82	107	286	1	190
ATA58204.1|CE5	7.94e-82	107	286	1	190

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	8.83e-20	148	273	70	186	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
5X88_A	7.43e-17	154	266	16	127	Chain A, cutinase [Malbranchea cinnamomea]
3GBS_A	1.88e-16	154	272	14	131	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	7.70e-16	154	272	5	122	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
1XZE_A	8.70e-15	151	273	18	142	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	7.57e-30	147	281	45	174	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	2.91e-25	150	273	20	139	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|G4MZV6|CUTI2_MAGO7	2.13e-22	151	276	30	151	Cutinase CUT2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CUT2 PE=1 SV=1
sp|B8NCM8|CUTI3_ASPFN	1.38e-21	119	272	17	156	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_039350 PE=3 SV=1
sp|Q2U199|CUTI3_ASPOR	1.38e-21	152	272	36	156	Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000113 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000012

TMHMM  Annotations     

There is no transmembrane helices in EKG11562.1.