CAZyme Information: EKG11384.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG11384.1
• CAZy Family: AA3|AA3
• CAZyme Description: Sialidase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:K2RMG4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		43569.47	4.8489

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000484:106965-108131(-)

Full Sequence      

MAVSTETGYHEDLRSVSDDPPRIEAYLPTTTVQSHASNLLLLDDGELLCSWFGGSQEGCS
DISIYLSRLKPGSQKWEAPLQVSDDPSRSEQNPVLFQAPDSNELWVIYTAQEAGHQNKAI
IRRRVSTDRGATWSPATQLFPEIGAFVRQPIVVLDNGTWVLPIWYCRAPDGFQWTGNDDI
SAVRYSNDRGATWKEQAVPNSTGCVHMNIRRGPDGTYLAFFRSRWADNVYRSTSSDCIDW
SPPQPIGLPNPNSGICFDVLPSGKLALVFNNSSATPDMRRREGLYDDITPEAEKLKNQPA
VDGKEAIWGTPRSALSFGISEDFGLTWRFKTIEDTDGYCMTNNSRDKINREASYPSIATG
EDGWIHIAYTYFRQRIKYVRVREDYAVA

Enzyme Prediction     

No EC number prediction in EKG11384.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	39	369	1.1e-21	0.8742690058479532

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404074	BNR_2	1.39e-61	49	367	5	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
227036	COG4692	4.21e-58	22	386	21	376	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
271234	Sialidase_non-viral	1.13e-43	49	382	28	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
405545	PSII_BNR	0.008	126	219	44	162	Photosynthesis system II assembly factor YCF48. YCF48 is one of several assembly factors of the photosynthesis system II. The photosynthesis system II occurs in Cyanobacteria that are Gram-negative bacteria performing oxygenic photosynthesis. One of the three membranes surrounding these bacteria is the inner thylakoid membrane (TM) system that is localized within the cell and houses the large pigment-protein complexes of the photosynthetic electron transfer chain, i.e. Photosystem (PS) II, PSI, the cytochrome b6f complex, and the ATP synthase. YCF48 is necessary for efficient assembly and repair of the PSII. YCF48 is found predominantly in the thykaloid membrane. It is a BNR repeat protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63439.1|GH33	1.59e-169	3	385	1	393
CAK97293.1|GH33	1.13e-154	13	385	11	382
QUN32156.1|GH33	1.43e-154	13	386	18	393
BCS13746.1|GH33	2.42e-154	13	385	11	382
BCS02060.1|GH33	2.42e-154	13	385	11	382

PDB Hits     

EKG11384.1 has no PDB hit.

Swiss-Prot Hits     

EKG11384.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000008

TMHMM  Annotations     

There is no transmembrane helices in EKG11384.1.