CAZyme Information: EKG11305.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG11305.1
• CAZy Family: AA3
• CAZyme Description: Protein of unknown function DUF1275

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650		73876.52	9.1042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000494:24458-26691(-)

Full Sequence      

MARSTVLELASASTKQLPRQRLKIKGLRGQKAKLPTIVKADEAEKDLFSLTSTHKLSLKI
LPVTTAAFILASYYYWWLQHTFIRGFDQEGFGGNNDVVWRKRFLVLEILCAVPYQLKALV
DSLAIFTGEWRPKLRLLGDEVPPVDVAIVCCKEELDVILDTVRAALDTDYPSTKFRLIVS
DDGAQREVEAGVRELQKQYPHRQLFYTARQKTRASSHKAGNLNHVYRYVATLPGGPAPFL
ASLDADMICERHWLRAQLPHLILDPKMAFTCPPPRFYNVPVDDPLSQSLLVFQRFDEIAK
DRAGFPWCTGSGWVMKRAALAEVGGFPELSVTEDLLLGNLILGRGWRAAYVFETLQWGLV
PDSFHGHIEQRKRWNTGAVQAGMIMRFCLFGDKAKHLDFRQRLFGFTCPFSSSLATVGLL
QAVQNLAFFAGGWSNAVYADAGELKQLVRVAAFMWIMNFLRRCNTAVICGYAIAFRDNYC
TEFLGCYWALDHLKTFILPRWLGGKEKAFSARFVATGSIVDPLNERDEKLRAPWQQRVRS
VLFHDGAIFPVLLGWADSSEFWTFLLTRLFWMPPAWPSNIVYYFRPLQYALFPPSVPDRE
ALLVRDENNVAYPTSEAKKTRTTWNGFGAEIVPTVLTAYTVGVLISTWWW

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	147	374	1.1e-21	0.9608695652173913

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	3.82e-77	142	380	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	2.17e-28	123	462	34	372	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	5.41e-20	142	403	260	509	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	8.74e-20	150	380	6	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
404520	Glyco_tranf_2_3	3.05e-19	142	374	1	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY01550.1|GT2	5.60e-127	59	650	168	770
QPG98637.1|GT2	4.73e-120	88	647	221	791
ATZ49458.1|GT2	5.30e-120	103	646	220	779
CCD45106.1|GT2	5.30e-120	103	646	220	779
XP_748682.1|GT2|2.4.1.-	2.54e-119	103	645	167	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.16e-21	136	403	122	396	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.29e-21	136	403	134	408	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.29e-21	136	403	135	409	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	4.48e-18	142	380	273	503	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RBJ2|BCSA4_KOMXY	3.48e-22	99	380	100	376	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	3.48e-22	99	380	100	376	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|O82859|BCSA2_KOMSB	8.76e-22	139	432	146	429	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	2.68e-21	139	432	146	427	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|P0CW87|ACSA1_KOMXY	5.18e-20	139	432	146	427	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999601	0.000403

TMHMM  Annotations     

Start	End
56	78