CAZyme Information: EKG10738.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG10738.1
• CAZy Family: AA3
• CAZyme Description: Glycoside hydrolase family 2 immunoglobulin-like beta-sandwich

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	AHHD01000505|CGC1	77663.08	5.7335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000505:176200-178372(-)

Full Sequence      

MAADAYPRPDFQRTSLHWQSLNGPWDFIFDDDDVGLSEQWQLKGLPESVTVTGAASSKPA
YESENESITAKIAANTQNLIKDNLAFRSSSSTTNKKRQIQVPYVFQCPASGINERGDHEV
LWYQRPLSDPRSAEQKNRRDRVILRFGAVDYDAKVWLDGHFVGGHRGGHVPFELDITDSL
DSSPPEPLRLTLRVYDSAYDLTQPRGKQYWGAKPESIFYTPSGGIWQPVWLETVPSARLA
DSSFGTVLRSNDIESGDLHAHIALLGRKVGHKYSIEVEASFAGIPVAKSPKKDLPKDKNH
VKLDLNLRLSQEQLSSLPDAVREAAPLGNDRCWRNSLALWSPDFPQLYDLKLRLFDVSGK
LLDEVKTTTGMRSLNWTRGDGALHLNDRPIFQAMVLDQGYWPETFMTPPSQEHLKADIEL
TKRMGFNGCRKHQKVEDPVFLYWADRLGFIVWGEMGNAYQFSQEYVERFNQEWIEAVKRD
INHPSIITWTPVNESWAYTSLKDNIEQRNHIRALYYLTKTLDPTRPINDNCGWEHVCTDL
TTYHDYSDAPALAETCSTLQGILGPKAGRPMFVEPIQGLDPGAEHRPGAVVLNTEFGGVN
IAPATGNSADEWGYTTASDPDDLLQRIDRLMRAVVQGGHSSGFVWTQLADIEQETNGLYS
FDRKEKLSAAKVKGVLDEVLRVFYSSRGF

Enzyme Prediction     

No EC number prediction in EKG10738.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	13	677	3.9e-99	0.6156914893617021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.46e-33	6	528	1	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	5.30e-29	20	527	14	445	beta-D-glucuronidase; Provisional
236673	ebgA	1.78e-20	99	525	99	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	8.00e-14	19	235	2	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
397119	Glyco_hydro_2_C	2.29e-12	414	554	38	192	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL03470.1|GH2	0.0	5	685	3	685
QKD54841.1|GH2	0.0	6	685	3	682
QGI95766.1|GH2	0.0	6	685	3	682
QGI64883.1|GH2	0.0	6	685	3	682
CCT68937.1|GH2	0.0	6	685	3	682

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	2.10e-57	93	675	59	578	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	2.82e-19	121	527	73	450	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	6.95e-19	121	527	98	475	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
3GM8_A	2.72e-18	120	527	67	421	Chain A, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5UJ6_A	5.09e-18	122	506	79	430	Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18835|BGLR_CANLF	4.19e-20	121	546	99	510	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	1.70e-19	99	525	82	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	2.02e-19	120	624	57	513	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|O97524|BGLR_FELCA	1.20e-18	121	546	99	510	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|Q4FAT7|BGLR_PIG	4.88e-18	121	527	100	479	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EKG10738.1.