CAZyme Information: EKG10619.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG10619.1
• CAZy Family: AA3
• CAZyme Description: Glycolipid anchored surface protein GAS1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		57449.17	4.0879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000516:47915-49629(-)

Full Sequence      

MKSFGIAAAAAALFARAALADVPPIVIKGSKFFYSNNGTQFYIRGVAYQQEYSTNSTSSD
EGADNYKDPLADASACKRDIPYLTELRTNTIRVYAVNPDSDHDECMQALQDAGIYVVADL
SSPGNSINRNDAAWNDKLYERYTSVIDAMAKYNNTLGFFAGNEVSNQANNTDASAFVKAA
VRDSKAYIKSKGYRTIGVGYATNDDADIRVDMADFFNCGDAEDAIDFWGYNIYSWCGDSS
FEKSGYDVRTEEFANYSVPVFFAEYGCNEVQPRTFSDTPVLFGDKMNDVWSGGIVYMYFQ
EENDYGLVSVDGDSVSTLKDFSYYSSQIQKATPTGVNSASYTPTNTKAQDCPTVGSAWQA
KATPLPPSPNTELCQCMYNSLSCVVSSDVDTDDYGDLFGVVCGLNDEACAGITHNATTGT
YGAYSMCNTTEQMAFVLNRYYELADSSSSACAFSGSATLKSAVTPTGQCSSLIKEAGTAG
TNTITASVTGTGSSSGSSSSGTSTGAAAPIGAPTFQIGGAFQMGAYIVGAVLTGAGMILL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	20	330	9.7e-141	0.9871794871794872
CBM43	382	470	2.4e-19	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	1.09e-168	21	331	8	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	1.59e-25	381	458	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	1.03e-15	381	471	1	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA29359.1|CBM43|GH72	3.89e-244	1	487	1	492
UJO23972.1|CBM43|GH72	3.89e-244	1	487	1	492
SMR63749.1|CBM43|GH72	1.31e-238	1	487	1	489
SMQ55427.1|CBM43|GH72	1.31e-238	1	487	1	489
SMY29109.1|CBM43|GH72	1.31e-238	1	487	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.57e-121	23	441	34	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	4.42e-121	23	441	34	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	4.42e-121	23	441	34	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	7.48e-205	1	540	1	545	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|B0XVI5|GEL4_ASPFC	1.67e-199	8	540	6	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	1.67e-199	8	540	6	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|P0C955|GEL3_ASPFU	1.93e-197	26	486	17	478	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	2.14e-197	26	486	17	478	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000314	0.999656	CS pos: 20-21. Pr: 0.9722

TMHMM  Annotations     

Start	End
517	539