CAZyme Information: EKG10151.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG10151.1
• CAZy Family: AA1
• CAZyme Description: Glycoside hydrolase family 12

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247		25788.37	4.1519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000526:170241-170984(+)

Full Sequence      

MKLSTTVLCAGAAALASAAPSKTLNRRADFCDQWGSVETGSYTVYNNLWGEANADSGSQC
TGVDSLSGSNLAWHTSWTWTGGAGQVKSYANVVLSDIKQVQLSAISSLPTTWKWSYTGSD
IVADVAYDLFTSSTAGGDEEYEIMVWLAALGGAGPISSTGSKIATTTIGGVSFDLYKGPN
GSMTVFSFVASSEAQSFEADLKDFIDYLSSNQGLSTSQYIKSIGAGTEPFSGTDAKFTTS
AFSVSQS

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	100	245	1.8e-45	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	3.37e-48	40	245	1	205	Glycosyl hydrolase family 12.
235746	PRK06215	1.71e-22	31	247	41	238	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40371.1|GH12	1.84e-111	15	245	9	238
QRD82782.1|GH12	1.84e-111	15	245	9	238
BAE58022.1|GH12	1.84e-111	15	245	9	238
QMW28300.1|GH12	1.84e-111	15	245	9	238
UDD56303.1|GH12	1.84e-111	15	245	9	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VL8_A	2.31e-96	21	245	5	227	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
4NPR_A	2.61e-96	30	245	27	241	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VLB_B	9.90e-94	29	245	6	220	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
5GM3_A	6.38e-59	28	245	1	217	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
6K9D_A	8.76e-59	31	245	4	216	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UK93|XGEA_ASPOR	3.27e-112	15	245	9	238	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xgeA PE=3 SV=1
sp|B8N3L3|XGEA_ASPFN	3.27e-112	15	245	9	238	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xgeA PE=3 SV=1
sp|Q0CRC9|XGEA_ASPTN	5.37e-111	1	245	1	248	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xgeA PE=3 SV=2
sp|Q5BG78|XGEA_EMENI	2.33e-107	12	247	5	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|A1XP58|XGEA_ASPNG	8.11e-99	14	245	8	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger OX=5061 GN=xgeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999748	CS pos: 27-28. Pr: 0.9073

TMHMM  Annotations     

There is no transmembrane helices in EKG10151.1.