CAZyme Information: EKG10025.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG10025.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		44500.72	6.6050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000532:55502-56857(-)

Full Sequence      

MPACWPRSRNKVLAAICLAVLVPYVLLSLSGTSSPLPLTLRGSDLLDDVFNQTLGFQKIF
VINLPSRDDLRDSMSLAAALTGLDIEYVDGVTEAEEKTLPPGSKETNLAKGSLYAWRAHM
NVLRMIVEQNLTSALVLEGDVDWDIRIKQQMRDFALASQLLVQPLAGTKDRFIDPTYPEP
LPDQRPVNIDVGKWGRGATVKPTTSAYGDIDRWDLLWVGHCGTRFPKLSDGNAPLGRALL
NNDASVPEQQHLDVENGGWDLLREYPAHTRIVHRARVSTCTFGYGISRPGARRLLYELGI
RKMTGTNDMMFRSVCDGVDGRPLFTCLTVQPQLFNHHRPAGDTAALSDINDLSGQRNEQG
YTKNIRWSTKLNFEKLLSARTDYIDLFPDGEPERKVGPW

Enzyme Prediction     

No EC number prediction in EKG10025.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	56	310	2.5e-21	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.33e-17	58	144	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	3.13e-05	56	223	1	172	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO20871.1|GT25	2.80e-129	8	394	45	449
QIX00324.1|GT25	1.92e-127	46	396	40	386
QIW97151.1|GT25	2.43e-126	6	392	5	388
SMQ53899.1|GT25	3.32e-121	34	385	67	418
SMR61313.1|GT25	3.32e-121	34	385	67	418

PDB Hits     

EKG10025.1 has no PDB hit.

Swiss-Prot Hits     

EKG10025.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998417	0.001601

TMHMM  Annotations     

Start	End
12	34