CAZyme Information: EKG09927.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG09927.1
• CAZy Family: AA1
• CAZyme Description: Glycoside hydrolase family 35

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
997		108505.67	4.6092

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000561:18042-21085(+)

Full Sequence      

MARLLSLTSALLPLLAQLPSASAQEWPIHDTGLTDAVQWDHYSFIVEGKRVYLFGGEMHP
FRLPVPELWQDIVQKTKALGFNTFSFYTNWFFHNPHPNETDFETAAHDIGRLLAYANEAG
LFVAVRPGPYVNAELNAGGFPLWVTTGAYGELRDDNSSYAGAWTPYQDRIAQIVAPYQIH
KNGTVISYQLENEYGEQWLNSRTKTPNPPAVNYMVQLHENARRNGIDVPTTHNSPNLNDF
SWSKDQDTVGAGGNVDVLGLDNYPLCWSCDQSECTGVSNDYKLVEYYSWFQRNTPSVPSM
MPEFQGGRYNPLDGDAGQCLEPMGPEFRNLFYRHNIDQKVTAMVLYTLFGGTNWGWMAAP
FIGTSYDYAAPIAEDRSLRDSWYETKSLALFTRVAEDLREADRVGNSTSYSTNSAVLATE
LRNAETGGAFYIARHANSVTGEPVAFHLRVKTSIGNLTIPQREGQIELNAREAKIVPTDF
RFSGQRLIYSTAEVFTYVELDGKPTVALWVPDGESGEFFLEGKGNVSATASPSDGVTFHQ
DARGLIVNFANQTGTTVIDTDAARFVLLDRTDAWKTFAPVLTTDPHAPVDQTVLVQGPHL
VRTATVEDDTLKLTGDTSEETTLQIFASASIKAVTWNGEALSTTSTPYGSLTATLSGPAE
VTLPSLSALSWKTAPSLPEIAPNYTLSPAVWKPANASTTPSQFTAATTPYLYIDALGFHV
GNHIYRATFTGPASGVYLALQGGTGFGWSAYLNGRFVHAEPGSSELEATNATIAFTNATD
GENVLVILMDNSGHEQRAEALEIRGITNATLLGNGAGFDAWHVAGTAGEAASTTLDPVRG
VYNEGGLAGERLGWHLPGFDDSAWAAGSPSEGFSGAAVRFYRARVALDVPAGHDAAVHFT
MKALGSQAVRALLYVNGYQFGRFRPAVSTATDFPVPPGVLDYAGENEIVVAVWAQSEEGA
QVEVGWEVQGVVRSGLDVRFDGAYLRPGWSEERLAYA

Enzyme Prediction     

EC	3.2.1.-:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	44	388	1.3e-77	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	5.55e-82	43	389	1	315	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	4.11e-64	398	575	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	3.47e-45	397	576	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	2.09e-30	33	374	26	323	beta-galactosidase; Provisional
404274	BetaGal_dom4_5	4.44e-30	849	958	2	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19904.1|GH35	0.0	20	996	28	1016
CBX93453.1|GH35	0.0	21	997	27	1006
AOV94179.1|GH35	0.0	14	997	17	1014
QRC94630.1|GH35	0.0	25	997	34	1009
AGS42423.1|GH35	0.0	20	997	2	1001

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IFP_A	1.14e-156	37	963	46	975	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	3.15e-156	37	963	46	975	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	1.48e-154	33	962	42	972	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
1TG7_A	2.39e-154	37	963	6	939	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
3OG2_A	4.66e-137	33	962	22	970	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2W791|BGALB_PYRTR	0.0	15	997	16	1009	Probable beta-galactosidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) OX=426418 GN=lacB PE=3 SV=1
sp|B8NKI4|BGALB_ASPFN	0.0	16	997	15	1020	Probable beta-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacB PE=3 SV=2
sp|B6QLF0|BGALB_TALMQ	0.0	23	997	21	1009	Probable beta-galactosidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) OX=441960 GN=lacB PE=3 SV=1
sp|Q0CMF3|BGALB_ASPTN	0.0	3	997	6	1022	Probable beta-galactosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=lacB PE=3 SV=2
sp|B0XNY2|BGALB_ASPFC	0.0	22	997	25	1015	Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999762	CS pos: 23-24. Pr: 0.9751

TMHMM  Annotations     

There is no transmembrane helices in EKG09927.1.