CAZyme Information: EKG09817.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG09817.1
• CAZy Family: AA1
• CAZyme Description: Pectate lyase catalytic

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248	AHHD01000565|CGC1	25593.87	8.3284

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000565:43669-44415(+)

Full Sequence      

MQFKYAALAAALAAVGSTQSLPIPASRGVDPNKGQRIVKPGNPFDGGMKEFGRGVVCNDK
ADTGVRNAVFVIEDGGVLRNAIIGADAVEGIHCEGKCTIENVWFRDVCEDAITLKGNGPY
TITGGGAQNAGDKVIQHNGKGELRISNYQVNNVGKLFRTCGNCSNNGGPRSIVATGIRAF
GVTSDLIGINSNYGDKASITGSCGNTKTVCQEYVGIEKGANGGKDSEKRVPPVGACTGQG
GLARLPSC

Enzyme Prediction     

No EC number prediction in EKG09817.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	34	215	1.7e-69	0.9536082474226805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	8.91e-92	20	219	1	199	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7219057.1|PL3_2	7.56e-75	6	248	5	245
AKC92822.1|PL3_2	4.40e-72	1	248	1	243
UJO24501.1|PL3_2	6.71e-71	13	248	10	241
CBX97807.1|PL3_2	1.81e-69	8	248	7	246
AKC92820.1|PL3_2	3.20e-69	1	248	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	3.99e-31	39	219	4	200	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	4.66e-30	39	219	122	318	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	2.29e-24	38	161	11	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	4.28e-24	37	162	15	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	4.38e-24	37	162	16	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C4B8|PLYE_ASPCL	4.35e-67	20	236	33	245	Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=plyE PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	6.75e-66	20	248	39	264	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|A1DBJ7|PLYE_NEOFI	2.82e-65	14	236	27	245	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q2TW49|PLYE_ASPOR	5.00e-64	20	228	36	239	Probable pectate lyase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyE PE=3 SV=1
sp|B8NX10|PLYE_ASPFN	5.00e-64	20	228	36	239	Probable pectate lyase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000265	0.999718	CS pos: 27-28. Pr: 0.7716

TMHMM  Annotations     

There is no transmembrane helices in EKG09817.1.