CAZyme Information: EKG09490.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG09490.1
• CAZy Family: PL3
• CAZyme Description: Fungal chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		45977.10	6.3634

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000640:7818-9165(+)

Full Sequence      

MASVVGYREESALFQRVLESYKPSDGLELLLVGIDGNEKEDLRMAQVVREVYPGCTTYIP
IAEPLGIKALRFAELHAFGPSYAPPPDLEVRLAQLDQLPKDARKEANDKAMLQLIQETQD
LFASHGLLENKRGSAMEVICLYQHHMCKKDIIFTNTIASIVFQKARGLDLLWTSDSDTLV
MPDTLSKVLGAMNLDEAIGGSSATLGIHNAQENWQAKMVAAMYWSDLAIARSVLGSTDTI
DCLPGPCAAFRVSAIERVIFSWYTQTCLGVRMVVNDDRHLTTLVLLQNYKVTNMACALAL
TDTPTTISRWVLQQLRWERAVHVEGLQYPHLYAKHGPALFFNALNRYYYPICLGLHLSRY
VWDGEALFRFSIIDMACRMLLYTLYNAMAHQVPIKEHPDKPSRRMDDT

Enzyme Prediction     

No EC number prediction in EKG09490.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	2.99e-24	175	320	85	231	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
224136	BcsA	3.00e-13	169	372	139	338	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133033	Chitin_synth_C	1.84e-12	175	317	81	237	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	7.21e-11	162	258	74	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404400	Glyco_transf_21	3.06e-05	169	319	33	174	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ29540.1|GT2	4.73e-112	1	386	89	481
ATZ50038.1|GT2	1.31e-108	1	386	89	481
CCD46426.1|GT2	1.31e-108	1	386	89	481
APA09675.1|GT2	2.72e-99	1	386	89	512
QGA20888.1|GT2	4.66e-86	1	386	110	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	3.13e-22	4	320	89	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	1.37e-21	4	320	89	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O57427|HYAS2_XENLA	6.44e-25	4	353	89	390	Hyaluronan synthase 2 OS=Xenopus laevis OX=8355 GN=has2 PE=2 SV=2
sp|Q61647|HYAS1_MOUSE	3.54e-23	3	365	104	432	Hyaluronan synthase 1 OS=Mus musculus OX=10090 GN=Has1 PE=1 SV=1
sp|O08650|HYAS3_MOUSE	4.70e-22	140	353	186	394	Hyaluronan synthase 3 OS=Mus musculus OX=10090 GN=Has3 PE=1 SV=2
sp|O00219|HYAS3_HUMAN	6.30e-22	140	353	185	393	Hyaluronan synthase 3 OS=Homo sapiens OX=9606 GN=HAS3 PE=1 SV=3
sp|O57426|HYAS3_XENLA	8.58e-22	123	366	153	396	Hyaluronan synthase 3 OS=Xenopus laevis OX=8355 GN=has3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EKG09490.1.