CAZyme Information: EKG09448.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG09448.1
• CAZy Family: AA1
• CAZyme Description: UDP-glucuronosyl/UDP-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		42729.60	9.7033

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000662:285-1472(-)

Full Sequence      

MIEKAGFVIVPCQPRVEGRSVAEDLRWKLPELVGSERIGRDFIEGQLAAMRELRPDVVMH
GMWPFASLAARMLGLPTIAFLPLPLHPTCLASGLVRDLPDSISVLTRLPRPLRQRLARAG
SRLMTKAPIFHQQRLGAAASACGWANKGALSLFEAVQAKLTVVTDLPAFYTRCRLPDTFR
LTGPVFASNSDAAYGGNTAELDPGIVAAMRRGGRPAILLTMGSSSTSELLFEAIRALARP
QGSDGDCNLEDWNVVVLVSPSVCRLDEARTVAGDDLRFLVTDQFVPGPAVSTLADAVVTH
GGQGTVQTAIAAGTPIVGVGLHMEQQTNLDHIMDAGAGIRIQLRRWRAPIIRRAVHNVLT
NPAYRSRAAALAETMRTLDGPRTAAVRMWEFLLKL

Enzyme Prediction     

No EC number prediction in EKG09448.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	11	392	1.2e-28	0.8507853403141361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	1.54e-23	42	385	84	392	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	5.79e-23	37	385	75	383	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
340817	GT1_Gtf-like	5.33e-21	2	385	44	398	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
223779	MurG	1.78e-04	200	384	169	344	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
340861	GT28_Beta-DGS-like	2.24e-04	176	373	164	345	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU04159.1|GT1	5.95e-139	2	394	30	409
CAE7193809.1|GT1	7.81e-139	2	394	55	434
CBX94155.1|GT1	1.37e-138	2	394	55	434
QRD01923.1|GT1	1.85e-138	2	394	55	434
AGY75149.1|GT1	6.52e-85	6	394	58	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IYA_A	2.50e-12	150	385	190	413	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3OTG_A	9.63e-08	28	381	104	396	Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]
6J31_A	2.90e-07	212	385	226	387	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	2.92e-07	212	385	229	390	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
2IYF_A	9.38e-07	212	385	230	391	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5U6W6|GLTR2_MYCTA	2.12e-15	40	373	109	407	PGL/p-HBAD biosynthesis glycosyltransferase MRA_2985 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) OX=419947 GN=MRA_2985 PE=3 SV=1
sp|P9WFR1|GLTR2_MYCTU	2.12e-15	40	373	109	407	PGL/p-HBAD biosynthesis glycosyltransferase Rv2958c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2958c PE=1 SV=1
sp|P9WFR0|GLTR2_MYCTO	2.12e-15	40	373	109	407	PGL/p-HBAD biosynthesis glycosyltransferase MT3034 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3034 PE=3 SV=1
sp|Q7TXJ4|RNTF_MYCBO	2.38e-14	40	373	120	418	PGL/p-HBAD biosynthesis rhamnosyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2986C PE=3 SV=1
sp|P9WN08|RNTF_MYCTO	2.38e-14	40	373	120	418	PGL/p-HBAD biosynthesis rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3038 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000006

TMHMM  Annotations     

There is no transmembrane helices in EKG09448.1.