CAZyme Information: EKG09353.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG09353.1
• CAZy Family: AA1
• CAZyme Description: Glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608	AHHD01000706|CGC1	68179.13	7.3680

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000706:15842-17922(+)

Full Sequence      

MKLDSKTASFYYSRPSEWLAGRRAVVPCANILGGGSSINFMMYTRASASDYDDFQAKGWT
TKELIPLMKKHETYQRASNNRDLHGFEGPIKVSFGNYTYPIMQDFLRATESQGIPTTDDL
QDLVTGHGAEHWLKWINRDTGRRSDSAHAYIHSTRSVHQNLHLVVNTKIDKVILDGDQAV
GVQTLPAKPLHPKQKQEPKIYRARRQIIVSGGTLSSPLILQRSGIGDPEKLRKAGVKPLV
NLPGVGLNFQDHYLTFAPYRATPDTESFDDFVRGDPIVQQRVIDQWNINGTGPLATNGIE
AGVKIRPTEEELKWIDTWPFPEFRSGWESYFKDKPDKPVMHYSVISGWFGDHMLMPPGKF
FTMFHFLEYPFSRGSTHIVSPNPYEAPDFDAGFMNDRRDMAPMVWGYIKSRETARRMKAY
AGEVTSMHPFFAYDSTAKAQDLDLINTKAYAGEAHLSAGIQHGSWSRPLEAHKEATPNYL
NSACSPVRDDLEYSKDDLLAIEEWVKRHVETTWHSLGTCSMAPRGGNSIVKHGVVDERLN
VHGVKGLKVADLSICPDNVGCNTYSTALLIGEKCAVLTGEDLGYSGAALDMKVPTYHAPR
EITHLSRL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	1	583	6.8e-231	0.9067796610169492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.48e-69	11	575	67	528	choline dehydrogenase; Validated
225186	BetA	1.29e-57	1	575	56	530	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	2.75e-43	21	253	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.97e-26	370	574	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.73e-10	29	571	128	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6999707.1|AA3_3	0.0	1	608	59	665
CBX94274.1|AA3_3	0.0	1	608	59	665
AAK14990.1|AA3_3|1.1.3.13	0.0	1	608	59	665
QDS71826.1|AA3_3	0.0	1	608	59	665
QRC95327.1|AA3_3	0.0	1	608	59	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	2.92e-317	1	596	59	650	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	2.28e-208	3	599	64	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	3.70e-207	3	599	64	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5OC1_A	3.05e-42	21	581	72	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6YS2_AAA	6.74e-42	12	588	67	572	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P04842|ALOX1_KOMPG	1.50e-316	1	596	59	650	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|F2QY27|ALOX1_KOMPC	1.50e-316	1	596	59	650	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	2.71e-312	1	596	59	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2R038|ALOX2_KOMPC	2.71e-312	1	596	59	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|P04841|ALOX_PICAN	6.88e-294	1	596	60	651	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EKG09353.1.