CAZyme Information: EJT82596.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT82596.1
• CAZy Family: GT69
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J3NMR3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		24817.17	8.7159

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385395:7984254-7985018(-)

Full Sequence      

MQIFPLATLAVSLLAATASAQSKVKVMLLGDSITEISCWRPKVWSQLSSAGLGNSVDLVG
SMTSLQGKCGNPPAGFDRNHEGHSGWQAYDIARSNIASWVNTYKPDVLQFMLGTNDVNIG
KRNVQTILDSYTTIVNAARSANPKVKIVIDKMIPTRWSDATIESVNSAIPNWASQRSTSA
SPITVADCSRAAGFTNNMLESDGVHPNGQGDDFIAKQIGPKLIQAINAARTL

Enzyme Prediction     

EC	3.1.1.6:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	24	216	1.1e-52	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.04e-46	24	216	1	151	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.60e-15	28	210	1	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	4.17e-12	26	221	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	7.87e-09	104	210	48	156	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
239946	SGNH_hydrolase_like_7	2.89e-08	103	222	49	171	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB73025.1|CBM1|CE3	3.27e-119	14	227	12	223
CAP67628.1|CBM1|CE3	3.27e-119	14	227	12	223
CDP23889.1|CBM1|CE3	3.27e-119	14	227	12	223
UMZ45356.1|CBM1|CE3	1.95e-115	14	230	10	224
AEO54377.1|CE3	5.77e-107	14	230	12	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	2.17e-104	24	226	2	203	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	6.22e-104	24	226	2	203	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
2VPT_A	2.96e-17	20	205	2	178	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

EJT82596.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999751	CS pos: 20-21. Pr: 0.9771

TMHMM  Annotations     

There is no transmembrane helices in EJT82596.1.