CAZyme Information: EJT82454.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT82454.1
• CAZy Family: GT50
• CAZyme Description: Cutinase [Source:UniProtKB/TrEMBL;Acc:J3NMC3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
181		19162.72	9.5990

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385395:7620835-7621524(+)

Full Sequence      

MFPLPWSREDFGTKHTQHQAGYGAVTGPRFPGAVREAAKGKSVGMQGVNYEASFYGFLAG
GDKDGGGNMTKITTDFVNKCPNSNIVVSGYSQGAQVTHLAAQAMSPDVPAKISSAVVFGD
PLDGKPIQGVPKEKTLSICRDGDPIYRSAGTLVLIPHLQYDQGAGKAAQFVVSQMKTRRS
V

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	14	174	3.6e-34	0.9365079365079365

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.18e-42	11	174	8	172	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ32745.1|CE5	1.69e-36	16	171	42	196
ATZ57773.1|CE5	2.69e-35	23	171	49	196
CCD47236.1|CE5	2.69e-35	23	171	49	196
AAZ95012.1|CE5|3.1.1.74	5.23e-35	23	171	49	195
AAM10822.1|CE5|3.1.1.74	5.23e-35	23	171	49	195

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	6.28e-30	23	172	97	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	2.73e-12	77	175	96	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	1.21e-11	77	175	87	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	3.75e-10	23	154	41	176	Chain A, cutinase [Malbranchea cinnamomea]
7CY3_A	1.80e-09	79	175	94	193	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00298|CUTI_BOTFU	4.78e-36	23	171	49	196	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	9.29e-36	23	171	49	195	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q8X1P1|CUTI_BLUHO	1.17e-35	21	175	84	236	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|Q9Y7G8|CUTI_PYRBR	1.10e-31	16	176	43	202	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	2.59e-30	23	171	97	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000002

TMHMM  Annotations     

There is no transmembrane helices in EJT82454.1.