CAZyme Information: EJT81814.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT81814.1
• CAZy Family: GT22
• CAZyme Description: long chain fatty acid oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805		85454.54	6.4668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385395:5639204-5641780(-)

Full Sequence      

MEAAEHVPASPRVPDLVELPSDFWTPTQWSVFLALADAVLAPIVPESELEDKAAQIRMPD
DQFAQLLDRFDAAVARPGGDSDNNSSSSSSSSSSSDAKALARAVLKDSFSTNPALAGHLR
RTVSVTVHHRLRTRIGGLLGALSTRTGALFLTGRCIPLHLQPLHAREAALRRWLASYLPA
MRAFAKSVAALAQNSWVQASPLFKQASGYTDVPHPWRPGPGFEFEFLQFPRRGPTESDAD
SDAAAAAAAAAESEPVVIETDVVIVGSGCGGGVCAKVLAEAGHRVLVLEKGHHHPPSQLP
MPQEQGSRLLFENGGVAATTDGALNVVAGSTWGGGGTVNWSVCLQTQDYVRREWARGARG
VPWFESAEFQACLDRVCDHVGAPPGSEAAVRHTHRGRALLDGCARLGWRAAPLRQNSGGA
EHWCGRCTLGCHGGEKRGPAVSWLPDAARAGAVFAEGFRVDRVLFGGDEATGEKVATGVV
GTWTSRDPQGGVAGPVESRVVREVVVKAKKVVVSAGSLWSPVILKKSGLENPNIGKNLYL
HPCNIVGAYYDQELNPWEGGIITSYCSEFEDLDGKGHGVKLEATCQVPYMSLPMLPWRGA
ADFKLAAARFGRMDAYIALTRDRDPGAVLADPATGEPVIDYRPSAFDRAHTLEGVVALSR
ICHAAGAREIRPLLPGVEPFVRRPKEVAAAAAAAAEAEEKTDGQDAAFEAWVAELRRVGN
APPLAPFSSAHQMGTCRMAPRAEDGVVDPEGRVWGVDGLFVADASVFPSASGVNPMVTNL
AIADWIARGVDRELRGAEVAGRVVG

Enzyme Prediction     

No EC number prediction in EJT81814.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	249	787	7.3e-80	0.9762773722627737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	2.25e-41	310	543	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	1.19e-30	275	797	23	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.26e-29	630	783	12	140	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	5.18e-08	731	789	473	533	choline dehydrogenase; Validated
274143	pyranose_ox	1.46e-04	724	783	476	535	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	3.64e-193	103	794	85	734
QRD04249.1|AA3_3	4.61e-14	257	784	11	587
ADT70776.1|AA3_1|AA8|1.1.99.18	1.25e-12	261	784	245	774
SMQ46758.1|AA3	1.47e-12	263	788	8	512
SMR43118.1|AA3	1.47e-12	263	788	8	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	8.37e-09	263	795	9	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3T37_A	1.75e-08	261	788	19	518	Crystal structure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
4HA6_A	2.70e-07	261	788	3	502	Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]
7DVE_A	1.10e-06	701	794	405	508	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]
4YNT_A	6.03e-06	261	768	7	542	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	6.25e-94	258	795	237	747	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q94BP3|FAO4B_ARATH	8.41e-80	258	778	236	726	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|B5WWZ8|FAO1_LOTJA	6.06e-79	258	778	235	728	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|O65709|FAO4A_ARATH	2.51e-75	258	783	222	711	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9LW56|FAO3_ARATH	1.85e-74	258	794	231	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000005

TMHMM  Annotations     

There is no transmembrane helices in EJT81814.1.