CAZyme Information: EJT81509.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT81509.1
• CAZy Family: GT2
• CAZyme Description: endoglucanase E1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	GL385395|CGC20	46283.82	5.6748

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385395:4714882-4716111(+)

Full Sequence      

MFLLISVLLLGGFFHYMWKAEAALGVPWQPDAASQLFAQRPLPAPVARTFVDTYTLPLRA
RGRDVVDAEDRRFKLSSVNWYGGSDELFIPGGLDVQHRDVIARTVRALGFNSVRLPYSDE
MVMANPAVLPHLLAANPDLIGMRALDVFEAVVTALTDAGVAVIVNNHITTATWCCGADPC
DAGWANDHLGPICRVSQTEEDWIRHWEIVMERFVGNPRVVGADLRNEVRGLWGTMPWDRW
ASAAERCGNRLLRMNRDWLIVVGGTESGNDLRGVERRPVRLDVEDRVVYSAHVYAWSGWG
STEGRFAQRPYASFVRTMRENWAYLVERDIAPVWVGEFGAPHLPGAGDVNYWQNLMRYLK
AIDADFGYWAINPRKPKDNGKETYCLVEDDWVTPVLDYRMKDMVELMRA

Enzyme Prediction     

No EC number prediction in EJT81509.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	378	3.9e-158	0.9936507936507937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.21e-29	101	373	29	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.64e-13	104	398	81	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62768.1|GH5_24	1.70e-264	2	409	4	411
UQC80596.1|GH5_24	3.03e-248	1	409	105	513
EAA35171.3|GH5_24	1.89e-238	1	408	67	477
CAP59961.1|GH5_24	1.47e-235	4	408	5	426
CDP22603.1|GH5_24	1.47e-235	4	408	5	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	1.40e-45	62	393	10	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	5.35e-45	62	393	10	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
3VVG_A	1.36e-29	64	393	19	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	3.54e-29	64	393	19	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	3.98e-29	64	393	52	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	6.35e-45	61	393	42	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	3.03e-43	62	393	51	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|C0HLA0|GH5FP_CHAOB	5.97e-32	53	391	26	379	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P10474|GUNB_CALSA	9.24e-29	58	393	630	984	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P50400|GUND_CELFI	4.17e-25	58	393	46	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.480836	0.519148	CS pos: 22-23. Pr: 0.2537

TMHMM  Annotations     

There is no transmembrane helices in EJT81509.1.