CAZyme Information: EJT80109.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT80109.1
• CAZy Family: GT1
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:J3NFR9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857		93502.89	5.9355

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385395:371517-374239(-)

Full Sequence      

MNLRMRCTGSCCSSPQDSTMAKQIDVEDVLKKLTLVEKVELLSGIDFWHTRPVHRLGVPS
VRLSDGPNGVRGTKFFNSVKAACFPCGTAMGATFNLALLEEAGKTMGADAKTKSAHAILG
PTINIQRSPLGGRGFESLSEDPVVTGLGAAALIRGIQSTGVQATVKHFVCNDQEHRRNAC
QSILTDRALREIYALAFQLAVRDGQPAAIMTGYNGVNGTYCSESDELLGKLLRGEWGWDG
LVMSDWYGTYSTTDAAVAGLDLEMPGPSKFRGELLKFNVQTDKVRRHVLDERVRAVLKFV
NRCAAAGVEENGPETTALDTPETAAFLRRIGNESLVLLKNDGGVLPLKRDKKTVVIGPNA
KVATYHGGGSASLAAFYAVTPWDGIKAKLESEPGYAIGSYSHKMLPLLGMATVTDKGELG
MTMRVYNEPPTSSHREMTDEYVFTKTEFFFIDYYNKKLRSNLWYADFEGFMVPEADEEWE
FGIVVHGTANLYINDELVVDNTTHQRQGTAFFGSGTMEEKGRYKLSKGQKYHVKIQFGSA
PTSELANESGLPGQGAMRLGGCRVIDVASEIRRAAELARGADQVIVCAGLNADWEGEGQD
RAGMDLPPPMDDLIAAVAAANPRTVVVMQSGTPVHMPWVRDVAALVQAWYGGNETGNVIA
DVLFGDANPSGKLPLSFPVRCRDNPAFLNYRTEGARVLYGEDVYVGYRYYEFADRDVLFP
FGHGLSYTTFALSGLEVRADEGGHRVDVEVNVANTGAVAGAQVVQVYVAPKQAARVNRPL
KELKGFAKARLAPGETRRVAVELDVRYAASYWDEDRGQWCAEKGEYEVIVSDSSAAEEGR
TLRGSFKIPETFWWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	53	265	1e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.86e-72	7	840	19	761	beta-glucosidase BglX.
224389	BglX	1.49e-62	55	362	57	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.87e-57	335	707	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.80e-37	33	804	60	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.55e-29	84	297	88	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56956.1|GH3	0.0	23	857	12	844
UQC84651.1|GH3	0.0	25	857	5	833
UKZ86562.1|GH3	0.0	24	857	4	836
UKZ67932.1|GH3	0.0	23	857	3	834
UKZ50443.1|GH3	0.0	24	857	4	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.18e-266	23	857	3	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.37e-260	23	857	3	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.64e-130	24	852	3	678	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.42e-111	33	855	12	676	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	8.38e-102	26	850	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	0.0	23	857	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	23	857	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	0.0	23	857	3	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.21e-318	23	857	3	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	7.82e-316	23	857	3	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EJT80109.1.