CAZyme Information: EJT79797.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT79797.1
• CAZy Family: GH92
• CAZyme Description: GH131_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J3NUC6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	GL385396|CGC19	42461.02	5.6570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385396:6835725-6837095(+)

Full Sequence      

MKTSFLTLLTVLAASVAAGPVPSGSYGLEARGGNKAAEGAGNNQPTPVLVAALVMAPVPV
LVQVQVLAAALVMAPVLVLMLMLMLMLVLVLALVLVLVAALVKAPAPVPVPVPVLVLMLM
LMLVLVLVLVAALVKAPVLVPVLVLVLVAALVKALVLVPVLNIQPEGFNVLASVFKSAVV
KGDGLVFSDLITFPDVAASIFDKAGNTKPFAISIDDKSIFIPQGGQAQANIRRADLLPSI
RSQLDDVAVKGVRTLHFSVQRDAASPLNATHDYQLVSLESKDFSKHQFDVRTGAGNGNNI
AVVGTDAGGAVQEEIFKTAFGEGAFENFAIKLDFDQNTMQVFHSTGNAALKQVTEPIAND
LSGLGEYHFALQKNPVGANPQPTGIKEAVIYGGIFMEDSTSGTVTLQ

Enzyme Prediction     

No EC number prediction in EJT79797.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	168	403	2.6e-64	0.9176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	5.88e-77	179	402	30	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64201.1|GH131	1.98e-126	164	407	125	367
UQC76763.1|GH131	3.27e-124	165	407	113	353
UQC91294.1|GH131	2.97e-61	168	407	116	364
CAE7208497.1|GH131	2.59e-59	168	407	45	293
QBZ65172.1|GH131	1.51e-56	162	407	36	293

PDB Hits     

EJT79797.1 has no PDB hit.

Swiss-Prot Hits     

EJT79797.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999697	CS pos: 18-19. Pr: 0.9754

TMHMM  Annotations     

Start	End
5	27
49	71
78	100
110	132
139	161