CAZyme Information: EJT78906.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT78906.1
• CAZy Family: GH74
• CAZyme Description: trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697	GL385396|CGC2	77771.58	5.9292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385396:4296516-4298805(+)

Full Sequence      

MPAMAPLWKLATAAAASSLAVNALYINGSEVTPCDSPIYCHGELLKQVELAHPFADSKTF
VDMPTIKPVNEVLAAFDKLQKPLSNNTELQNFLRENFAKAGGELEEVPNSELATDPVFLN
KLNDTVIREFVEKVIGIWPELTRRYKGPGQCSECANSFIPINRTFVVAGGRFREPYYWDS
YWIVEGLLRTGGAFTQISKNTIENFLDLVETIGFVPNGARIYYRNRSQLPVLSQMVRVYV
EHTNDTSILERAVPLLIKEHQFFVNNRSVEVTSRSGQTYTLNRYAVVNTQPRPESFREDY
ITANNRSYYAASGIIYPEARQLNESEKAELYSHLASGAESGWDYSTRWLAKPNDAAKDVY
FPLRSLNTNNMVPVDLNSILYANELAISEFLNQTGNATGAAEWKRTAERRSEAMFALMWN
ETLWSYFDYNMTSKEQNIYIPLDDDATAFEQTTAPAGKQVLFHVAQFYPFWTGAAPAQLR
DNPLAVQRAYSRVDAYLGLKGGAIPATNLRTGQQWDEPNVWPPLMHILMEGLTRVPATFG
ESDPAWLGVQDLALRLGQRYLDSTFCTWYATGGSTSQTPQLQGLTPEDTGIMFEKYGDNS
TNVAGAGGEYEVVEGFGWTNGVLIWVADQFSTRLKRPNCGNITAANVHPSGGRRKRSLEQ
RSALEMHSSDAAWIKRFGRKAAKRSLGRTAGLGGGAV

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	54	629	2.8e-159	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	2.37e-135	54	624	3	502	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.03e-128	39	629	13	550	alpha,alpha-trehalase
224541	TreA	1.81e-84	36	636	53	558	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	1.35e-76	26	622	35	528	alpha,alpha-trehalase TreA.
237326	treA	1.32e-71	32	628	39	534	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN38003.1|GH37	0.0	4	693	1	692
QBZ56021.1|GH37	0.0	4	693	1	692
AEO53147.1|GH37	0.0	11	684	7	682
AEO70020.1|GH37	0.0	4	684	1	683
UQC80667.1|GH37	0.0	22	677	1018	1668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	1.21e-71	56	630	40	554	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.69e-70	56	630	40	554	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	2.58e-64	32	635	42	544	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	3.69e-63	31	644	5	514	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	6.60e-60	31	644	5	514	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	8.80e-117	24	639	39	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	1.90e-109	33	634	24	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|P19813|TREA_RABIT	8.53e-108	33	634	27	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|O43280|TREA_HUMAN	9.82e-108	33	634	27	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|A8J4S9|TREA_APIME	1.35e-105	19	634	26	572	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.324877	0.675104	CS pos: 22-23. Pr: 0.3671

TMHMM  Annotations     

There is no transmembrane helices in EJT78906.1.