CAZyme Information: EJT78900.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT78900.1
• CAZy Family: GH72|CBM43
• CAZyme Description: glycosyl transferase family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		44871.10	8.5611

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385396:4284750-4285913(-)

Full Sequence      

MRFLLPRRVARRARLLFVLAAFCTLLVFFWSGGGALRLSPHRISNAGLYRPSEDAASLCR
RHGWRPFRPPKSFSWWPLAPAEEHPRPRKVYDLFMINNEMEWLEVRLNTTYELVDHFVVV
EAPLTFTGLPKPLVIKENWDRLRPYHAKLFYHELQYPPDYNPPRPWDREDLQRDASLEQA
LPRLAAEVPGAAPRAGDALVVADVDEIIRPETLRLLRACEFPRRLTLRSRFYYYGFEFLH
RGPEWPHPQATYYEGARSSSAGGGGTTIKPTNLRNSDGGFAPLSWLDMADLWNAGWHCST
CYRTVADVLRKMASFSHVPLNQEVFRDPNRIADRVRRGKDIWDREGEHYDFVPNNTDMPP
FLLANPERFGYLLNRTGESAGFEDYLP

Enzyme Prediction     

No EC number prediction in EJT78900.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	56	373	9.1e-82	0.9823943661971831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	3.82e-51	49	373	51	342	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55398.1|GT17	1.09e-160	16	387	9	369
UQC80666.1|GT17	1.41e-136	18	385	15	377
AEO66100.1|GT17	8.23e-131	50	384	44	355
AEO53918.1|GT17	9.15e-130	18	384	16	354
UNI21852.1|GT17	4.72e-122	36	386	47	373

PDB Hits     

EJT78900.1 has no PDB hit.

Swiss-Prot Hits     

EJT78900.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999972	0.000059

TMHMM  Annotations     

Start	End
13	35