CAZyme Information: EJT78782.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT78782.1
• CAZy Family: GH72
• CAZyme Description: GPI mannosyltransferase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		59027.18	9.7905

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385396:3905862-3907836(-)

Full Sequence      

MWRRTYLFLILVRLWFALSPSYIHPDENFQGPEVIAGQIFSYPVRHTWEFTSDRPIRSVF
PLWPIYGLPMLLLRWLWIGNGKDGEIPPIAVFWSLRVLMFVLGFVLEDWAIHELISSPRH
RRVAVLLVASSYVTWTYQTHTFSNSIETLVVAWSLVLTERIVASPRDALMASAVLGMLAI
FGFFNRITFPAFLLIPGIRLIPCFWNRPLSLAVLLLSALTATVVAVILDTAFYTKHQVSW
ADIVFHPVITPLNNLLYNISPANLAQHGLHPWYQHLLANIPLLLGPGVLLLVNAQLSPRL
YSAISGLFVLSIFQHQEARFLQPTVPLILSSVKLPKSRPLRRAWITAWIIFNAAMGVLMG
VYHQGGVIPTQVFMSKQPDATKAIWWKTYSPPIWLLNGKNEVLETMDVMSLGREDLFAQL
ETMATCDAPADRRSMEYLREKNGTYLVAPVSATGLDPYLSNKGLAGLRFREVWRHEKHFN
FDDLDWGEDGVWNTLSRLFGRRGLAVWRVTKSCPERKG

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	395	4.4e-78	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	5.08e-46	5	394	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	4.04e-05	3	377	39	426	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57845.1|GT22	8.41e-302	1	518	1	520
ATY60246.1|GT22	5.00e-297	1	513	1	515
QLI65346.1|GT22	1.77e-294	1	515	1	517
UQC77828.1|GT22	4.05e-294	1	513	1	515
UNI14407.1|GT22	1.12e-293	1	513	1	515

PDB Hits     

EJT78782.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	3.20e-289	1	515	1	517	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q4WTT7|SMP3_ASPFU	3.99e-174	1	512	1	544	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	1.99e-173	1	512	1	540	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q5BAX7|SMP3_EMENI	2.26e-165	1	507	1	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	2.32e-94	10	485	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.006780	0.993171	CS pos: 23-24. Pr: 0.7566

TMHMM  Annotations     

Start	End
59	78
89	111
123	142
176	198
211	233
272	294
344	366