CAZyme Information: EJT78724.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT78724.1
• CAZy Family: GH72
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J3NRB8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	GL385396|CGC17	36464.22	10.4651

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385396:3732103-3733071(+)

Full Sequence      

MHAKAILIGLLSASGVIAAASPDAPLQARDSKHVLGKDKTLRIMALGASITYGQGSDKTG
GYRQELVRRLKDGKNKVEMVGERGQGDFPENRVEGWPGKRIDEIKKDQMSSVEKLKPAIV
LLNVGTNDAVQNKDIDKAGERYEDLVREILKKSPKAVVLASNLVHNRNKDTEDRVKNINK
QIERVANKLSKDTKRVVFVNMFDQGPNPDKKDGESEYHDDTHPNERGYKKMAEVWEKAIK
EADERKLLKPGKLRKLLNKAGEKVKKLADKPKEKLKKMSEKKKDKLSKQKTKMLDEIRKI
IQDEFKKVEDAIKDLKKDIKKN

Enzyme Prediction     

No EC number prediction in EJT78724.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	41	239	2.5e-54	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.30e-43	41	239	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.15e-24	45	230	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.91e-20	43	238	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	1.02e-14	43	235	1	224	GDSL-like Lipase/Acylhydrolase.
239947	SGNH_hydrolase_YpmR_like	2.98e-13	43	233	2	199	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63269.1|CE3	4.90e-52	1	242	1	242
AEO66483.1|CE0	9.31e-47	33	235	35	234
CAP71774.1|CE3	3.90e-44	41	235	60	253
CDP31165.1|CE3	3.90e-44	41	235	60	253
QPG99528.1|CE3	7.75e-40	8	242	11	242

PDB Hits     

EJT78724.1 has no PDB hit.

Swiss-Prot Hits     

EJT78724.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000636	0.999346	CS pos: 29-30. Pr: 0.3483

TMHMM  Annotations     

There is no transmembrane helices in EJT78724.1.