CAZyme Information: EJT78569.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT78569.1
• CAZy Family: GH7
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	GL385396|CGC11	47374.42	8.1276

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385396:3262932-3264236(+)

Full Sequence      

MVNAPWLGGLAARAALFASARLETRAETRATYSQRTSDAAGAVQAWYKQGTGQWETGWWN
SANVLTTLADFVMIDSASAAKHNLAALASNTFTQAQKPIAAAAPAVANNAVTNSAISTHE
IAVAESSEIGSMIMSKYEALEASTPGRARLGGKKLMGRQSQGNAGFLNHFYDDEGWWALA
WIRAFDVFKDRRYLDMAEDIFTDMEKGVDDVCGGGIWWNKDRKYKNAITNQLYFSVAASL
ANRDVKRRRPVAYRDIAVKQWAWLQGSGMQNADGLFNDGLNINTDGTCTNNKQQTWTYNQ
GVVLGGLVELHALTGQKDMLDKAFRIAEATVSKMVNGDGILKESCEPNGCGQDGAQFKGI
FVRNLRTLWLASPSRPPLRDFMLKQADSIWSRDRVEASNRLGLVWHGPANVPKDPVADTH
SSAMDALVAAIAVV

Enzyme Prediction     

No EC number prediction in EJT78569.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	26	430	2e-89	0.9497206703910615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	9.94e-38	170	406	85	331	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	2.08e-22	139	433	59	349	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56212.1|GH76	2.48e-147	1	433	1	440
UQC89700.1|GH76	2.54e-104	7	433	189	578
ATY65455.1|GH76	1.14e-102	32	433	37	406
CAP67367.1|GH76	3.34e-102	1	434	1	393
CDP24780.1|GH76	3.34e-102	1	434	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	6.34e-21	163	405	82	314	Chain A, Lin0763 protein [Listeria innocua]
4C1S_A	8.16e-10	170	401	106	338	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
4V1S_A	1.88e-06	168	336	139	303	Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	4.39e-06	168	336	139	303	Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05031|DFG5_YEAST	7.80e-14	172	388	122	349	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.975542	0.024484

TMHMM  Annotations     

There is no transmembrane helices in EJT78569.1.