CAZyme Information: EJT78525.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT78525.1
• CAZy Family: GH7
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:J3NQR9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	GL385396|CGC18	91143.19	5.2491

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385396:3149685-3152291(+)

Full Sequence      

MAEPYLDVENVVANLTIEEKISLLSGKDFWQTRDIPRLNIPSLRFSDGPNGVRGQRFFNG
VAAACTPCGTGLAATWDAELIEQAGRLLGRECIAKGVHVLLGPTVNMLRSPLGGRGFESY
SEDPVLSGNLASAIINGVQSQGVAACIKHFVCNDQEHERQAYNAVISERALREIYLMPFQ
IAQRDSKPMAFMTAYNRINGLHVSEDPRILQDILRQEWGFDGLVMSDWFGTYSAAESVNA
GLDLEMPGPPRVRGLNVLMSIGCQKVAEHKLNERARNIVNLANRLYSPDRPFVQSAPETT
VDCAETSAELRRLAADGLVLLKNEKSILPLDKSKTVAVIGPNANLASYAGGGSASLKPYY
TTTPLQGVKEHVPAAQYAIGAVGYKQLPLLSLVAKTCDGTGRKGVLCKFYNEPATEANRV
LRDMVHTEISDMLLVDYAHPDVNPELFYMDIEGDFTPEVTGEHVFGCSVRGTARVLVDGE
LVVDNAMNQTLGGTFMGAGTREERGSKVLEAGRTYQVVLQFGSSQTQTVKKKGATAMRGG
GVRVGCAPAVESEAEIARAVRLAASVDQVVLAVGLTGEWESEGFDRDSMDLPGRSDDLVR
AVLAANPNTVVVVQSGTPVTMPWAAEAPAILQSWFGGNEGGNAIGDVLFGAVNPSGKLPI
TIPHRVEDNPAYLNFGSENGRTLYGEDVYIGYRFYERTKKDAPFPFGHGLSYTSFELGGF
GIETTSSDPGLDATVKVGVDVENSGKVQGKAVVQVYVRAQAPQAVKRPLKELKGFAKVSL
EAGAKTRTSIEFSRKYATSYWDEERDMWASEAGVYEVLVGQSSTDVTVAGSFTVNKPTWW
RGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	247	1.5e-71	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.27e-83	31	833	95	763	beta-glucosidase BglX.
224389	BglX	4.88e-78	27	370	47	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.97e-59	318	692	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.34e-49	11	790	56	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.53e-41	37	281	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64267.1|GH3	0.0	3	843	4	857
ELQ32819.1|GH3	0.0	3	843	4	849
UJO24157.1|GH3	0.0	7	843	7	834
SMR61167.1|GH3	0.0	7	843	9	836
SMQ55981.1|GH3	0.0	7	843	9	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.39e-254	7	843	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.44e-248	7	843	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.69e-141	6	835	3	669	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.55e-129	12	835	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.50e-105	11	835	57	827	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	6	843	4	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.64e-318	6	843	4	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	8.00e-317	6	843	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	8.00e-317	6	843	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	9.43e-311	4	843	2	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999936	0.000084

TMHMM  Annotations     

There is no transmembrane helices in EJT78525.1.