CAZyme Information: EJT78261.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT78261.1
• CAZy Family: GT69
• CAZyme Description: chitinase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	GL385396|CGC26	41078.54	5.1019

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385396:2512279-2513412(-)

Full Sequence      

MKPTLIPWLAALLLLLAAPSLSRPLDDAADTLPVRAPSISLPRLAIYYQTTHDATTGRPI
SMLPLVTEQHIALTHLIVCTLHVRADRELYLNDFPPSHPRFATVWAEAAVLRDSGVRVVA
MVGGAAEGSFAADTLDAPEGSPLFERAYGQLRDALRRFGLQGLDVDVEQPMSQRGAARLV
GRLRADFGPEFTITMAPVASALTTREWPNLSGFSYRELEATSGRDVEFYNAQFYNGFGDM
IDTGAFDSVVAAGYDPRRIVAGQVTTPDNGAQWTPFDQLARTMGELRRKYGEVGGIMGWE
YFNGKPGGQAKPWEWAQQITAILRPGKQVQLRVTRDDAARLEAAWATSVAGKVSGNASLA
GGDDVKPDVDYWAMVSE

Enzyme Prediction     

EC	3.2.1.96:4

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	7.38e-142	43	304	1	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	2.84e-10	47	235	4	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	3.98e-04	106	240	64	199	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
226000	Chi1	0.001	94	239	77	215	Chitinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56737.1|GH18	2.31e-170	9	376	10	382
CAL49862.1|GH18|3.2.1.96	1.11e-128	15	376	10	358
CAZ16624.1|GH18|3.2.1.96	1.11e-128	15	376	10	358
CAL49863.1|GH18|3.2.1.96	1.28e-127	32	376	23	358
EHK47006.1|GH18|3.2.1.96	6.07e-119	15	376	11	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AC1_X	5.40e-119	41	326	2	282	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]
2Y8V_A	1.19e-68	43	323	13	288	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

EJT78261.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000234	0.999733	CS pos: 22-23. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in EJT78261.1.