CAZyme Information: EJT76808.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT76808.1
• CAZy Family: GH31
• CAZyme Description: Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:J3NZM5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		39706.10	9.3204

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385397:4760396-4761768(+)

Full Sequence      

MPPATAARRSGLSRSQNQIRAAEMGPAMRRQDRVRQIWLGAAGGCPQWINTDKPLQALDF
YMICSFPASRSPFLTANSTPTKMQGWSSLIVKAGLLGLACLDLASALKPSPGCGKINTLK
AGNNSITVAGAGSNGRRWYLLNLPAGYDNKHPYRLIFTLHALGGSADQVVAGTGGYLPWY
GFPRLVNDTTGAIYVAPNGLDRGWANTGNRDVTLVSAVVDQVKADLCVDEDLLFSAGFSY
GASMSYAIACSLPKVFRAVGAQSGGAMSGCQGGSEPIAFYGQHGVAGDLPIAQARQIRDR
FIKNNGCTQQTFPTVSAGSGTHARVDYKGCKEGFPVTWIEYDGGHTPQPMDKGTKMTWAA
DETWRFFSQFK

Enzyme Prediction     

No EC number prediction in EJT76808.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	134	292	7.3e-19	0.6079295154185022

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	3.33e-16	132	369	41	306	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	3.41e-09	132	280	372	523	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	3.80e-05	191	264	14	97	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF60572.1|CBM13|CE0	8.80e-83	107	370	34	300
CDP24862.1|CBM1|CE0	8.87e-83	95	371	8	279
CAP67448.1|CBM1|CE0	8.87e-83	95	371	8	279
AEY86349.1|CBM13|CE0	9.05e-83	107	370	35	301
VBB74107.1|CBM1|CE0	1.25e-82	95	371	8	279

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WYD_A	2.09e-06	139	334	23	209	C-terminal esterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7RWX8|FAED_NEUCR	1.81e-74	83	370	1	289	Feruloyl esterase D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=faeD-3.544 PE=1 SV=1
sp|Q0CDX2|FAEC_ASPTN	2.45e-72	103	368	17	268	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|A2QYU7|FAEC_ASPNC	9.82e-69	95	367	10	267	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|A1C9D4|FAEC1_ASPCL	1.17e-67	90	367	5	269	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-1 PE=3 SV=1
sp|A1CC33|FAEC2_ASPCL	2.34e-67	110	367	26	269	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000003

TMHMM  Annotations     

There is no transmembrane helices in EJT76808.1.