CAZyme Information: EJT76647.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT76647.1
• CAZy Family: GH3
• CAZyme Description: acetyl-CoA carboxylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1032	GL385397|CGC21	111075.13	6.6036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385397:4335768-4338866(+)

Full Sequence      

MADCIAPRSGPRRLLQAVGLGLMALGGTTAANVAADPGPGGTAPVRPFRLDQVRLGDGLL
QEKRDRTKDFLREFDERRFLVLFNKQAGRPSAGGVAVPGGWEDGGLLSGHWAGHYMTALS
QAYADQGEEVFKAKLDWMVQELAACQKAITARMGGGGGGGSGGQQPGNNETVGRVAGKFG
NALQLNKEAQGQQYVTLPQETVNQLRDFTFASWVKLASNQTWSRLFDFGRDTTVNMFLTP
RADQPGFAPRFAITTGGSGQEQQINGKIALPVDEWVHIAVTLEGTTGIMYVNGQVAGTNA
GMALNPTSLGNPGNRWIGRSQYGDAPLSAAVDEFHVFNRALSAAEVRSLQASAAGTTGGG
NIAWYRFDENGGTTLVDASPNGRDAGIVSDRGSGPSAWVPTHPGYLGALPEDTVLRLGPP
RWAIYGGDAATNTWAPWYTQHKIMRGLLDAYYNTNNTQALDVVVKMADWAHLALTIGDKN
YPGYTGNLTRDDLNRMWDLYIAGESGGANEVFPELYELTGDSRHLETAKAFDNRASLFDA
AVEDRDILVLTRDKNPGPRRTDRLHANMHVPQFIGYLRIFEQSREQDYLDAARNFYSWVF
PHRQFASGGTGGNYPGSNNNAEMFQNRGNIANAIAENGAETCTTYNMLKLARNLFMHEHN
ATYMDGYERGLFNMIAGSRADTATTADPQLTYFQPLTPGASRDYGNTGTCCGGSGLESHT
KYQETVYLRSADGSALWVNLFVPSTLTWGEKAFSLRQDTAFPRADSTKLTVTAAGGGGPL
DIKLRVPAWAQRGTVTVTVNGEADPAAQTPLPGTYLTLARAWRAGDTIEMRMPFRVRVER
APDRPDTQALMRGPVLLQIVGRPPATGGANSGYWELSLYRHLKLDGDYGHAAVVATGGGS
TDAVFSVAAAAGGQKLTARPYYVGDRQAASSYFRRVEPRVVFGRLDAGVANHKRNNGLPR
YDVPVQGVSVPGTDGPTFLDVLWDKAPFGGHAAFVAAVREVVAQFVSAGVYSVEEGEGIV
RTAGQAEAELAV

Enzyme Prediction     

No EC number prediction in EJT76647.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	402	857	8.8e-143	0.8031809145129225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	1.42e-98	404	857	98	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	7.81e-62	437	922	130	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
404293	Laminin_G_3	3.72e-31	191	347	3	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
400342	Glyco_hydro_127	5.73e-10	52	147	1	95	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
214722	LamGL	2.58e-06	206	344	1	133	LamG-like jellyroll fold domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ61184.1|GH146	0.0	33	1031	56	1054
BCB86917.1|GH146	0.0	1	1031	1	1021
SBT46463.1|GH146	0.0	24	1031	45	1031
QOC92017.1|GH146	0.0	23	1030	43	1029
BCJ68139.1|GH146	0.0	38	1031	59	1031

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.92e-59	426	857	152	559	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.67e-57	426	857	152	559	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]
4QVS_A	1.44e-19	173	353	39	223	Chain A, S-layer domain-containing protein [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

EJT76647.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001301	0.998698	CS pos: 35-36. Pr: 0.7795

TMHMM  Annotations     

There is no transmembrane helices in EJT76647.1.