CAZyme Information: EJT76552.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT76552.1
• CAZy Family: GH3
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:J3NYW9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	GL385397|CGC18	45262.98	6.9148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385397:4081281-4082632(-)

Full Sequence      

MKPNCIIGGGLAASSARWAMYYDQYHTTAPPSKNVTAGITHVITAFAASDLFIGNTTGTY
TPFQPLSQIRSHFDDNVKVCMAIGGWGDTAGFARGARTEATRKEFAKNVGKTVDRLGYDC
VDVDWEYPGGNGADYRQNPNSGKVSEVETYPLLLSEIKKVIGKKELSIAVPSLERDMIAY
TATQVPKIAGVVDHIHVMTYDLMNRRDNVTAHHTDLMGSMAAIDTYLARGAPASKLSLGF
AFYAKWFNTAKGAECTSPVGCPAAVLEDAAGADTGKSGAFTFETANFAPAPTNLTVTTDD
SCGAGTSFKCKEGACCSQYGFCGTTAAHCGTGCQNPFGRCEGISTKDSFTKALKNAKTDA
VSGGEWYWDSQADIFWSWDTPALIKQKVQTIIKGKGLAGGFAWSLGEDTYDYSHLKAITA
ALKA

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	18	413	8.3e-50	0.9459459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.85e-77	17	408	1	307	Glycosyl hydrolases family 18.
214753	Glyco_18	4.67e-44	18	408	9	334	Glyco_18 domain.
119365	GH18_chitinase	1.35e-41	18	408	8	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	8.63e-34	40	413	29	344	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
119349	GH18_chitinase-like	1.62e-32	19	202	2	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAI44121.1|CBM18|GH18	1.15e-212	12	423	13	423
UQC80925.1|CBM18|GH18	8.90e-188	4	424	24	443
UPK97484.1|CBM18|GH18	2.00e-186	1	424	1	428
QPC76828.1|CBM18|GH18	1.45e-180	1	423	1	426
CEF74633.1|CBM18|GH18	1.18e-179	1	423	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3G6L_A	6.34e-20	76	247	104	280	The crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
1ITX_A	4.20e-19	18	248	67	311	Chain A, Glycosyl Hydrolase [Niallia circulans]
5Y29_A	9.98e-19	40	248	37	256	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	1.11e-18	40	248	37	256	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
6TSB_AAA	2.24e-18	42	245	57	263	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	4.71e-18	18	248	99	343	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q9D7Q1|CHIT1_MOUSE	1.22e-17	10	263	19	285	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|E9ERT9|CHI1_METRA	4.31e-17	76	252	122	303	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|P32470|CHI1_APHAL	1.87e-16	18	252	47	302	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|Q9W092|CHIT2_DROME	5.81e-16	18	249	50	289	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EJT76552.1.