CAZyme Information: EJT75155.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT75155.1
• CAZy Family: GH18
• CAZyme Description: initiation-specific alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		48356.09	6.8942

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385397:31013-32293(+)

Full Sequence      

MGSPPLLGSPLSPLSPRLSIPSSKISLRNRLPTQIRRCLPLYLTCLCVVLLILNADLVGI
SMPRHHRLNIRREAYKDYLNSKSGRHSATAPKTPARFPRKVWQTWKVDPLSFAERDSLTA
RTWTARNPDYRYEVLTDDNDMAYVEYHFGPDGFDRPDIVDFYRNVNATIIKADLLRYIIM
YAEGGVYADIDVEALKPAHRFVPERYAEEDVDLVIGVEIDQPQYKDHSILGSKCMSFCQW
TFMAKPRLPVMLHLIENIMGWLDGVAVEQGVAIPEVQLDFDKVISGTGPSAFTQAVLEDM
NMRRKLDESNGVSSGGKRGPYTWEDFHDLDESKVVSRILVLDVEAFAAGQGHSDSGNHNA
RGALVKHHYHASNWPSRHPRFSHPAYGEVERCNWDPMCVAKWDQDVAEFKKLPAEQQQQL
IAARQL

Enzyme Prediction     

No EC number prediction in EJT75155.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	119	203	3.4e-18	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.11e-19	75	258	60	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.69e-11	114	197	2	82	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60802.1|GT32	1.07e-252	1	425	1	434
UQC86260.1|GT32	8.45e-192	1	421	1	390
AEO66402.1|GT32	1.13e-183	7	421	5	390
AEO60901.1|GT32	1.68e-180	7	421	5	389
UPL04319.1|GT32	4.04e-179	7	416	39	420

PDB Hits     

EJT75155.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.16e-33	95	374	140	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	3.97e-29	97	367	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	2.09e-27	96	346	129	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	8.61e-26	95	367	94	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999956	0.000053

TMHMM  Annotations     

Start	End
38	60