CAZyme Information: EJT74993.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT74993.1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	GL385398|CGC23	54984.18	6.4593

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385398:4232166-4233863(-)

Full Sequence      

MLPSYSAKAKVTPRHQATGYSNGYPPSSNTLEFSPHRYQPRTTPSLRRRRRIIARLGIVT
ALVFFLCVVWPGFDTVASLFSLGLVGSGGAQSLVETVRYYDLSNVQGTARGWEREERILM
CVPLRDAESHLGMFFSHLRNFTYPHHLIDLAFLVSDSKDNTLKVLVDSLEKIQSDLDSDQ
WYGEVSIIEKDFGQKVNQDVESRHGFAAQASRRKLMAQARNWLLSAALRPYHSWVYWRDV
DVETAPFTILEDLMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALADTLDED
AVIVEGYAEYATWRPHLAYLRDPYGDPDMEMEIDGVGGVSILAKAKVFRSGCHFPAFSFE
KHAETEGFGKMAKKMGYSVVGLPHYTIWHLYEPSVDDIKHMEEMERERIAREAEEKEKAE
KAQKMKDTFGDAGGQWEKDKKAIENIAQGEKKPTDKAKAEGKAKADGKDTKDTKKTDDIK
AKKE

Enzyme Prediction     

No EC number prediction in EJT74993.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	95	358	6.2e-123	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	8.59e-161	96	358	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57164.1|GT62	1.40e-277	1	457	1	457
UQC75883.1|GT62	3.81e-259	1	460	1	460
VBB84024.1|GT62	4.20e-251	1	452	1	451
QKD59569.1|GT62	2.04e-249	2	459	1	460
APA12986.1|GT62	2.38e-248	1	460	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.82e-62	97	394	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	8.76e-163	96	443	61	408	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	1.99e-159	31	404	14	386	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	1.55e-126	96	401	171	523	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	8.98e-119	97	404	76	433	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	2.20e-61	97	392	73	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999799	0.000224

TMHMM  Annotations     

Start	End
51	73