CAZyme Information: EJT74896.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT74896.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450	GL385398|CGC6	48762.75	5.3804

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385398:3952591-3953943(+)

Full Sequence      

MTPISAIALALGLFAETGLAGVSVRKTGTAPTGYEVDFTLANDTASRVLVAGGLFPFTDQ
WHTGWQRSNGWSPRDYQAGDFVLPQAAGGLGDADWPYVMKRDGGGDWRLTVPLPSGTYNY
AFLVDCDAPFNCTFASGKWVMDPDNPPFVNVAGDATASSFQVPFDARFQATPAGGSDLNF
DYALPRADPAERGAVTTVNYTSPGSVWPAPDVHEFALYTPPGYHSSGPDREYPVLYLSHG
GGGNGLDWHGLGRMGGIMDTLIAEGSLEPTVVVMPTFYNIAPEYRFTYGLSGARAPDAPV
VRENYAAHLFPFVEANLRVSRSPARRAFAGLSLGGRLTYEMLVNATDYFAYFGIFSAAQG
IVGPGDLAAKAPALRRKGIFNSYGLYDFTFDIDRSIEVAMNANGIPYLSRIQPWGGHYWP
TWMDCLYHFGRSALWKPLPFDGRTGRGVKN

Enzyme Prediction     

No EC number prediction in EJT74896.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	214	428	2e-33	0.920704845814978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225256	Fes	4.66e-13	218	422	87	284	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
199889	E_set_AMPKbeta_like_N	7.99e-10	94	153	22	72	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
395613	Esterase	2.43e-07	215	364	10	147	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
225375	YbbA	9.98e-05	217	358	27	171	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
406865	AMPK1_CBM	3.03e-04	99	146	29	64	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW66742.1|CE0	2.85e-52	24	445	50	461
UQB68901.1|CBM48|CE1	1.88e-31	97	434	331	640
QDV29582.1|CE0	7.04e-30	217	437	67	284
UPK72241.1|CBM48|CE1	2.05e-28	97	429	334	647
ADV83427.1|CE0	2.31e-28	92	429	71	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	1.52e-26	97	429	68	380	Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	2.08e-26	90	431	41	340	Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	2.11e-26	90	431	41	340	Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	4.69e-26	192	444	29	268	Chain A, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.22e-25	192	444	29	268	Chain A, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P10478|XYNZ_ACET2	1.14e-23	192	444	48	287	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
sp|D5EXZ4|AXFA_PRER2	7.82e-19	97	429	358	664	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
sp|D5EY13|XYFA_PRER2	1.48e-18	98	434	428	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
sp|P51584|XYNY_ACETH	4.73e-12	157	352	801	974	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
sp|P31471|YIEL_ECOLI	8.64e-12	217	361	161	305	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999692	CS pos: 20-21. Pr: 0.9769

TMHMM  Annotations     

There is no transmembrane helices in EJT74896.1.