CAZyme Information: EJT74822.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT74822.1
• CAZy Family: GH16
• CAZyme Description: mannosyl-oligosaccharide glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	GL385398|CGC12	90710.40	7.2334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385398:3755532-3758277(-)

Full Sequence      

MKFRIALAFAALAAGASSAATADHSYDAGQRWGPYRPNLYFGVRPQVPKTLLAGLMWAEG
GARMLDTLRDTCEQDDGMEGYGWPLYDTRVGGRQEMHDARLGVDLATEFVKTPDGDNWAV
RVSGAARGGGVPPQIALVFHFTMEEMGVDETVKSLKCRVDGAGEAGEASCRGTDQSLGDF
TIELLPDQGNTVVEEVSVMDTLVPEDQIWQAKAAFTTISKSPTTTSGNGKGNIYFLKTVV
QAPFSLDLIYSTKGSKSTITHKFYTSFPQRVASVFRPSAAFQGEKNFIFTQALLSNLLGG
LGFFHGDSKLDESRAPEYDETDPKFWELAAEAMKRAKVATAPPRSLLSHTPSRPFFPRGF
LWDKGFHLIPVIEWDLDLAVSVLRSWLGLMDSDGWIGREQILGPEARSKVPAEFQVQYPH
YANPQALALLFPTILDKMANPFSYRGSPSRYLTDPDGAGKEILRELYGLLSKHYAWFRRT
QAGNFSTVYPRPEGAAAAAGEGYRWRGRTPQHTLTSGLDDYPRANPPHPAELHVDALAWV
GATASALARLAAHLGEPADAETYGRHPAAVLRSLDLLHWDEGAGAYCDATVAPAAADGRF
ERVCHLGYVSVMPLLLGLVGADSPRLPRLLELLGDPGRLWSPFGLRSLSAQDPGYGGGDD
YWRGAVWVNLNVLAALRLAELGGASNGKGETTAAAARLGAELKKRLVETVYQSWKQTGFV
WEQYSDKTGEGRRSRAFTGWTACVILLMGDTKSGAGGRGGEGAYTDGARRSGWWSGPGAS
RSGSGTGNGASTLTVIGVMGALAAVALLRRTLFGLFRGLVDRVRGTWGYARVQHRASD

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	530	750	6.5e-24	0.4368421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	1.14e-149	303	750	53	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	3.64e-55	32	218	3	202	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	0.004	639	681	510	554	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
215307	PLN02567	0.008	534	746	328	538	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO69881.1|GH63	1.43e-289	17	749	32	788
KAF2201713.1|GH63	7.68e-288	27	817	32	817
KAF2823603.1|GH63	2.24e-274	32	748	45	773
KAF2471559.1|GH63	2.99e-216	32	825	36	843
BAK64066.1|GH63|3.2.1.106	2.36e-215	32	748	46	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	8.87e-130	32	753	17	805	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	2.13e-119	32	748	39	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	3.37e-157	32	748	44	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.58e-128	32	749	47	831	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	5.07e-120	32	748	94	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	3.23e-117	32	748	96	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	3.45e-114	32	748	94	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999720	CS pos: 19-20. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in EJT74822.1.