CAZyme Information: EJT74435.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT74435.1
• CAZy Family: GH16
• CAZyme Description: Fn3_like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J3P439]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
716		79712.15	6.4661

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385398:2590480-2593749(-)

Full Sequence      

MARGNGPVLAVQQCPMNKCWYCTREPTSRSPNRLVFPVANFDLFVRAADYPFFEDICLRS
TRPHRTSNMGSELHARSPDELDYDGATPDTEVFTPVNPYGPGDVLGGTKDKKRLLAREKL
VRLSLEEKRTKVIPSKGIPSAKTSDGPNGARGGIFVGGTKAALFPCGISLAATWNKSLLR
DIGRHLASEAKARSANILLAPTVCLHRHPLGRRNFESFSEDPVLTGKLAAQYIGELQEKG
VAATIIKHFVGNEKETNRLTIDSRISERPLQEIYLRPFEIAVREANPWAIMTSYNLVNET
HADMHENVLKDILRGEWGYDGAGCDIGFPFSTKWRFEKLLTALEKGKLSLQDIDRAAENA
LALVQRVKGDDMSAEQEEREEDRPATHMEAGKAVELRVEMTNELRPAAKQKEFNMTHKYG
GCRIGFKEEDTVDYLQQAVDAARAADVAVIIVSLDAEWESEGYDRQTMDLPSDGSQDRLI
EAVLDANPRTVVVDQSGSPVTMPWADRVPAILRAWHQGQEAGNALADVLFGRKCPSGKLP
CTFPRRLQDTPAYHNWPGENLEVVYGEGVYVGYRHYERVRIAPLFPFGHGLSYTSFEYGR
PSLSGRALSGPDDVLELVLGVTLAGAETVQVYVADERSRLPRPRKGLAAFEKVFLEADET
KHLRIHIDRFAVGYYDTSVSRWVAGEGRFNVLTGASSADIRHQISFDVTQTFSWVF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	133	321	2.5e-55	0.8379629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.83e-60	164	707	120	763	beta-glucosidase BglX.
224389	BglX	6.58e-49	133	385	55	333	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.09e-45	450	573	96	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	9.97e-35	99	363	30	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	6.62e-31	116	678	53	701	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB72333.1|GH3	2.51e-309	87	716	36	908
AEO66128.1|GH3	9.54e-302	87	716	34	888
CDP23238.1|GH3	1.64e-301	87	702	36	896
CAP69216.1|GH3	1.64e-301	87	702	36	896
AEO53892.1|GH3	2.37e-301	87	716	31	884

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.22e-119	130	711	29	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.26e-100	133	700	32	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	2.63e-100	130	714	30	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.98e-97	130	714	30	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X42_A	7.23e-88	130	708	43	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	3.59e-130	120	704	15	834	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P14002|BGLB_ACET2	6.28e-119	130	711	29	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|A1CA51|BGLI_ASPCL	1.82e-112	130	715	30	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	3.76e-111	130	715	30	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	7.54e-111	113	715	3	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000089	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EJT74435.1.