CAZyme Information: EJT74081.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT74081.1
• CAZy Family: GH135
• CAZyme Description: mannan endo-1,6-alpha-mannosidase DCW1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508	GL385398|CGC15	53843.29	4.9814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385398:1467347-1468959(-)

Full Sequence      

MRLLRRVAAAACLLTQLPVANAAIQVDIKNPSSVRTAASTVAFGLMKYYAGNNTGQIPGN
LPDPYYWWEAGAMFGTMIDYQFLTGDKTYSDVTIQAMLHQAGELRDFMPKNQTKTEGNDD
QGFWAMAAMSAAENRFPDPPPGQAQWLALAQAVFNQYVTRWDTATCGGGLRWQIFTFNNG
FNYKNSISNGCFFNLAARLARFTGNQTYAEWAERVWDWTESVKLISPEFDFYDGASVESG
INCTKHDVIQWSYNAGIFLHGSAFMYNMTGNDKWRSRVDGIVNRNSEIFFNGTAMFEPAC
EGVNLCNNDQRSFKGYLTRWMAGTAALAPFTAERIAAQLRGHAELVPKACSGSPAKGFNG
VPGTACGFSWVQAPGVPAFDGDVGVGEQMNALGALMYTLALPRESTAAPGGGGNTGGGDR
GGGGGGGNGGGGGGSGGGSSGGDDEPPMAFVPVTGANGGTSQGDVNAGLAEKKEVQFEPI
TTSGKVAAGFLTSALALSITGFSIFLIM

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	405	1.1e-107	0.9441340782122905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	33	392	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.05e-06	36	350	5	303	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64721.1|GH76	5.49e-210	1	507	1	461
UQC82430.1|GH76	8.68e-209	1	499	1	452
QLI65312.1|GH76	8.00e-183	7	508	5	459
UNI18821.1|GH76	6.50e-181	23	507	21	457
AEO63329.1|GH76	3.86e-177	21	507	17	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.87e-113	28	395	30	399	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	1.39e-131	23	507	21	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.47e-127	24	403	19	386	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	6.84e-122	23	401	19	386	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	2.63e-118	10	507	8	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	1.55e-105	23	392	18	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999677	CS pos: 22-23. Pr: 0.9750

TMHMM  Annotations     

Start	End
486	507