CAZyme Information: EJT71870.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT71870.1
• CAZy Family: CE1
• CAZyme Description: alcohol dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		65842.90	5.7746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385400:2198139-2200025(-)

Full Sequence      

MHWRLVLSLVAAAATSASCADEETYDYIVVGSGPGGGPLAANLARAGHPTLLLEAGDDQH
DNPNISIIYNFLAAGNDESTRWDFFVKHSEDPARALKYERLTWRKPDGSFYVGLDPPEGS
KQLGIYYPRAGTLGGCAQHNAGVAFLPPGRDWDVVANLTGDRSWEAANMRKYFVRLENNR
YLPRGTRGHGFDGWLATIDTPAGWAGEDNDGTRIARALAGGMGVSTEDLPAQLGSDINAD
RPDRDRRQEFASLVSHADEDGFRSSPNNYIRATMADAKKYPLTLKLESFVTKVLFDTSPS
VAGAPRAVGVEVLQGRHMYSADPNYKAEAKGKKMTYRARKEVIVAGGAFNTPQILKLSGI
GPKAELERFGIPLVADLPGVGENMADNYEAHLLALKEGSPLNAGGIQTLLFRTPSAPTAD
RNFFAWCGSFSFDGFWPGFPENYGPEQFTCAIVQMNPKSQAGYVRLRSADPRDVPDINLR
FFEHNADQDLTELLEAERFLMGGVYNGTGPWNPLHPCKKGEPCSDSHVKEYIRDQAYSHH
ATSSARIGASDDPMAVLDSKFRVRGVRGLRVVDASAFPVVPGAFPVVPVMMLSEKASDDI
LAEAA

Enzyme Prediction     

No EC number prediction in EJT71870.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	20	603	7.6e-74	0.5097087378640777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.41e-58	260	601	196	532	choline dehydrogenase; Validated
225186	BetA	5.26e-54	39	605	22	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.13e-29	457	596	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.44e-19	258	603	215	579	Protein HOTHEAD
366272	GMC_oxred_N	3.65e-11	263	389	127	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ53739.1|AA3	0.0	1	604	59	662
VBB81166.1|AA3	1.30e-234	5	603	9	613
CAP64871.1|AA3	1.84e-234	5	603	9	613
CDP29384.1|AA3	1.84e-234	5	603	9	613
QRD01027.1|AA3	5.02e-210	21	603	25	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	5.41e-39	22	598	11	524	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.00e-38	22	598	11	524	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	1.37e-38	22	598	11	524	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6F97_A	3.49e-32	22	604	3	531	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	4.71e-32	22	604	3	531	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8G1Z8|BETA_BRUSU	9.56e-40	26	601	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1
sp|A9M9H8|BETA_BRUC2	9.56e-40	26	601	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) OX=483179 GN=betA PE=3 SV=1
sp|B0CKN4|BETA_BRUSI	9.56e-40	26	601	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=betA PE=3 SV=1
sp|A5VPA6|BETA_BRUO2	9.56e-40	26	601	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=betA PE=3 SV=1
sp|A6X2G7|BETA_BRUA4	2.43e-39	26	601	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000947	0.999035	CS pos: 19-20. Pr: 0.9262

TMHMM  Annotations     

There is no transmembrane helices in EJT71870.1.