CAZyme Information: EJT71402.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT71402.1
• CAZy Family: CBM66
• CAZyme Description: unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		61393.28	6.5001

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385400:853248-855895(+)

Full Sequence      

MSLSTPPSGPDGQGAETTPATASITSPPPTPTIADYLAELFAENVAAKIYRTASRAVGIP
HAFPEHVPQAGRGAGAYSHREAEFWTCGFFPGSVHCLLERLVRFPHSVRLDTTTNNTPNT
TIAAAQLRAIQAGLQHRRHHHHGDLQADEGNPTETLYVVGKPTPDRLRSSLSALLDSVLR
AASALATRYVPAARAVRSWDSRVQRNLTVEGTETNLLVIIDSMCNLDLLYYAAGQLGAGD
PTAAHLSAVATAHATTVLRTHLRPEEQPPSPDADDSDSFAAGSTRYAGQWYSTHHVANLD
PRTGAVKRHFTAQGWSDSSQWARGQAWAILGYAQTHAWTRDPAFLRAACGLADGRYVPPW
DFDAPPDADRGFVPRDSSAGVVAANGMLVLSQSLRASGGGGDDDSALADRFLRAAVALAR
DALLFALAPERAELLAVAGPGAGGCYYRHARIEVADADPGPVDGGCGGGGGSFEAILKHG
TANNNPDALRRYADHGLYIMVNINTENIHTLLAVAGPGAGGCYYRHARIEVADADPGPVD
GGCGGGGGSFEAILKHGTANNNPDALRRYADHGLVPLFWFP

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	79	412	2.2e-54	0.817629179331307

CDD Domains     

EJT71402.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21762.1|GH88	4.76e-101	11	497	36	509
QRD83416.1|GH88	1.87e-100	31	506	60	534
QMW44047.1|GH88	1.87e-100	31	506	60	534
QMW32019.1|GH88	1.87e-100	31	506	60	534
UDD56939.1|GH88	1.87e-100	31	506	60	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.66e-16	182	395	145	324	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	2.52e-11	179	394	114	296	Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	2.52e-11	179	394	114	296	Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	4.39e-08	156	341	118	264	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.41e-08	156	341	119	265	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	1.34e-19	176	390	144	326	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	1.30e-10	179	394	114	296	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	2.47e-09	176	394	139	323	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	3.13e-08	176	387	136	313	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	2.27e-07	156	341	119	265	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000006

TMHMM  Annotations     

There is no transmembrane helices in EJT71402.1.