CAZyme Information: EJT71210.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT71210.1
• CAZy Family: AA9
• CAZyme Description: GPI mannosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:J3PAE4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		51835.09	10.1084

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385400:350479-351939(-)

Full Sequence      

MSAKIPPPDRAGTGSSSQQIQPPQASTADAFFASPRAVYVAAALLRAGMLLYGVWQDAAS
PVKYTDIDYLVFTDAARFVADGASPYDRATYRYTPLLAWILLPTTFGSAGPSLWRLLWFS
SGKVIFAAADVAAGWLLVRILLLDGGGGGGGGDGGGGGGGGGTMSPARARRFAAVWLLNP
MVAAISTRGSSEGLLGALVAALLWAVLRRRVVLAGLILGFGVHFKIYPFIYAPAIVWWMD
DEHMSASPSPTSSSGKRRRRRDDGTTVIQRAAGFVTAPRLLLAAVSLSSFAALNLLMYAL
YGHPFLAHTYLHHVTRIDHRHNFSPYNTLLYLESASAATSGSSGSSSSSSSLGGSIESVA
FVPQLLLSTILVPLALAKRDLASAMLAQTFAFVAFNKVCTSQYFLWYMVLLPLYLPRSSL
VAGSRRKGLVALLLWVAGQAAWLQQGFELEFVGRSVFLPGLWLASLSFFLINCWILGVVI
SDVGAL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	185	480	2.8e-97	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	3.22e-82	36	480	9	415	GPI mannosyltransferase
252941	Mannosyl_trans	4.13e-68	185	480	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ54528.1|GT50	2.56e-187	25	483	15	427
VBB81264.1|GT50	7.10e-171	15	483	5	442
CAP65259.1|GT50	1.64e-169	11	483	5	442
CAD60578.1|GT50	1.64e-169	11	483	5	442
CDP29471.1|GT50	1.64e-169	11	483	5	442

PDB Hits     

EJT71210.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S4Z3|GPI14_NEUCR	3.53e-177	32	484	23	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.03e-158	31	484	4	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.51e-157	44	482	19	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	1.64e-154	29	486	2	431	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	4.14e-153	32	483	5	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999929	0.000065

TMHMM  Annotations     

Start	End
37	59
95	117
124	143
184	206
213	235
280	302
389	411
458	480