CAZyme Information: EJT69908.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT69908.1
• CAZy Family: AA7
• CAZyme Description: Beta-xylanase [Source:UniProtKB/TrEMBL;Acc:J3PH11]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		34000.40	8.8606

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385403:955423-956988(+)

Full Sequence      

MRRWAMKFGAKGRYWGTCVNPGVLNDGRASAVVKNGEDFGSYTAENEMKFDALEPSRGNF
NYGNADRIVTAAKAIGAHMRCHALVWHAQVPGWVRNGGFNKATLISIMETHIKNVVGHFK
GSCYAWDVVNEALNEDGSYRTGDSIWGRTIGATEFIPLAFKAARAADPAAKLYYNDYNCD
KPGRKATGAQNLIKMVKAAGAPIDGMGLQGHMSVGQVGPVSTLVQNLNAFTALGVDVAYT
ELDIAARSGSSQFAQQATDYGYVVQACMQVSRCVGITAWGFTDAHSWISGGNALIWDSSY
NKKPAYNAILNGFGR

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	11	311	4.2e-99	0.9636963696369637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	3.46e-128	10	311	7	310	Glycosyl hydrolase family 10.
214750	Glyco_10	2.12e-104	48	309	1	263	Glycosyl hydrolase family 10.
226217	XynA	1.69e-80	39	309	58	337	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68222.1|CBM1|GH10|3.2.1.8	1.33e-146	13	314	32	332
ADZ99358.1|CBM1|GH10|3.2.1.8	3.68e-135	13	314	33	331
AIG99409.1|CBM1|GH10|3.2.1.8	2.72e-114	14	314	33	337
AGV01049.1|CBM1|GH10|3.2.1.8	5.47e-114	14	314	33	337
QZJ84313.1|GH10	1.91e-113	14	314	34	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	6.94e-105	10	314	9	318	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	1.74e-97	10	314	31	340	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	1.75e-94	5	315	8	326	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
1V6Y_A	1.09e-89	12	314	13	315	Crystal Structure Of chimeric Xylanase between Streptomyces Olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex [Streptomyces olivaceoviridis]
3WUF_A	4.02e-87	10	309	11	308	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	8.13e-98	14	312	32	333	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|I1RQU5|XYN1_GIBZE	1.77e-97	5	311	24	338	Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYL1 PE=1 SV=1
sp|P79046|XYN1_HUMGT	6.53e-94	5	309	25	333	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|B3A0S5|XYNA_FUSO4	9.03e-94	5	315	8	326	Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) OX=426428 GN=FOXG_17421 PE=1 SV=1
sp|Q2PGV8|XYN2_AURPU	4.27e-92	5	310	35	352	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EJT69908.1.