CAZyme Information: EJT69281.1

Basic Information

• Species: Gaeumannomyces tritici
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Gaeumannomyces; Gaeumannomyces tritici
• CAZyme ID: EJT69281.1
• CAZy Family: AA2
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J3PHC1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		42736.23	5.7135

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GtriticiR3-111a-1	14749	644352	291	14458

• Gene Location: location=GL385404:174133-175448(+)

Full Sequence      

MLVTMATFWGGFRTSEAAPSRAWPRIRLASVAALWLLLLLLGAPARADCECGYAARVGND
TEPQLFTDLLETDFSRVGDMSLVSTDWTRQAFNVTRERARGRHGEMFAVANARANPDRDP
AARTGVGLNGGRAAGLELVVGSARVDGMVPVAEVDSARMDLLWGTYRVGMKLTGVPGTCA
AFFWYHNDTQEIDMEFLTREFNASSGTFPVNLVLQSRAAVEAGYDAQATGNFRKVNLPFD
PTADFHEYRIDFLEGRVVFYADGQVLAEMGGAAVPDRGGHLILQHWSNGNPLWSGGPPPR
DAVLTVSYVRAYFNSSAPAPARQGDRAGRCADVGAPGAVCQIPSAPDVRNPVFFTAVGNM
TNNQTVSGDPGPAGGQSGSPRVVSSVGLVVVVAASALAVLGL

Enzyme Prediction     

No EC number prediction in EJT69281.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	131	312	3.1e-87	0.9427083333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	7.12e-44	73	312	2	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	5.23e-10	164	303	69	201	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185693	GH16_laminarinase_like	4.83e-07	191	312	115	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
395585	Glyco_hydro_16	6.94e-07	162	265	32	124	Glycosyl hydrolases family 16.
185685	GH16_XET	5.11e-05	162	263	47	141	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62950.1|GH16_23	1.37e-142	31	367	27	360
UQC77992.1|GH16_23	1.55e-130	41	374	15	336
AEO58087.1|GH16_23	2.69e-120	45	368	55	394
VBB86764.1|GH16_23	1.00e-116	36	366	32	367
CDP32289.1|GH16_23	2.01e-116	36	366	32	367

PDB Hits     

EJT69281.1 has no PDB hit.

Swiss-Prot Hits     

EJT69281.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.079669	0.920322	CS pos: 47-48. Pr: 0.8326

TMHMM  Annotations     

There is no transmembrane helices in EJT69281.1.